fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G25280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os021774 not found in 445aa AT1G25280.1 1st_1st 0.684824902 Ia
Os021773 not found in 445aa AT1G25280.1 not_1st 0.684824902 II
Os029803 not found in 451aa AT1G25280.1 not_1st 0.682230869 II
Os019651 not found in 462aa AT1G25280.1 not_1st 0.662775616 II
Os019649 not found in 462aa AT1G25280.1 not_1st 0.662775616 II
Os040209 not found in 445aa AT1G25280.1 not_1st 0.648508430 II
Os004869 not found in 448aa AT1G25280.1 not_1st 0.626459143 II
Os009468 not found in 428aa AT2G18280.2 not_not 0.505836575 III
Os009471 not found in 416aa AT2G18280.2 not_not 0.505836575 III
Os029491 not found in 406aa AT2G47900.2 not_not 0.505836575 III
Os029490 not found in 406aa AT2G47900.2 not_not 0.505836575 III
Os037720 not found in 317aa AT1G25280.1 not_1st 0.430609597 II
Os022387 not found in 372aa AT1G53320.1 not_not 0.411154345 III
Os022386 not found in 372aa AT1G53320.1 not_not 0.411154345 III
Sb032660 ACQGAALRLSLAFLDS in 197/692 AT1G25280.1 1st_1st 0.695201037 Ia
SPLIMGLSLMLAGQAE in 382/692
Sb026173 not found in 642aa AT1G25280.1 not_1st 0.643320363 II
Sb028483 VSVFVELKLTLSSSSS in 564/671 AT1G76900.2 not_not 0.592736705 III
Sb027814 not found in 706aa AT2G18280.2 not_not 0.518806744 III
Sb014893 not found in 402aa AT1G76900.2 not_not 0.516212710 III
Sb024300 not found in 556aa AT2G47900.2 not_not 0.437094682 III
Sb031457 not found in 1013aa AT1G25280.1 not_1st 0.431906614 II
Sb030332 not found in 1740aa AT1G25280.1 not_1st 0.422827496 II
Sb032884 not found in 513aa AT1G53320.1 not_not 0.405966277 III
Gm041219 not found in 427aa AT1G25280.1 1st_1st 0.741893644 Ia
Gm021743 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm021742 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm021741 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm021740 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm003397 not found in 424aa AT1G25280.1 not_1st 0.696498054 II
Gm003395 not found in 424aa AT1G25280.1 not_1st 0.696498054 II
Gm044960 not found in 424aa AT1G25280.1 not_1st 0.693904020 II
Gm044959 not found in 424aa AT1G25280.1 not_1st 0.693904020 II
Gm054929 not found in 430aa AT1G25280.1 not_1st 0.691309987 II
Gm054928 not found in 430aa AT1G25280.1 not_1st 0.691309987 II
Gm028527 not found in 430aa AT1G25280.1 not_1st 0.683527885 II
Gm028526 not found in 430aa AT1G25280.1 not_1st 0.683527885 II
Gm003396 not found in 407aa AT1G25280.1 not_1st 0.609597924 II
Gm030081 not found in 414aa AT2G18280.2 not_not 0.527885862 III
Gm030080 not found in 414aa AT2G18280.2 not_not 0.527885862 III
Gm001764 not found in 415aa AT2G18280.2 not_not 0.522697795 III
Gm036751 not found in 389aa AT2G47900.2 not_not 0.517509727 III
Gm041730 not found in 385aa AT2G47900.2 not_not 0.514915693 III
Gm003133 not found in 414aa AT2G18280.2 not_not 0.514915693 III
Gm004126 not found in 400aa AT2G47900.2 not_not 0.511024643 III
Gm039266 not found in 423aa AT1G47270.1 not_not 0.503242542 III
Gm039265 not found in 423aa AT1G47270.1 not_not 0.503242542 III
Gm044675 not found in 414aa AT2G18280.2 not_not 0.501945525 III
Gm019438 not found in 359aa AT2G47900.2 not_not 0.485084306 III
Gm045746 not found in 362aa AT2G47900.2 not_not 0.477302204 III
Gm045745 not found in 362aa AT2G47900.2 not_not 0.477302204 III
Gm045744 not found in 392aa AT2G47900.2 not_not 0.456549935 III
Gm048089 not found in 410aa AT1G47270.1 not_not 0.428015564 III
Gm037352 not found in 381aa AT1G53320.1 not_not 0.424124513 III
Gm034540 not found in 378aa AT1G53320.1 not_not 0.422827496 III
Gm036752 not found in 290aa AT2G47900.2 not_not 0.411154345 III
Pt002868 not found in 423aa AT1G25280.1 1st_1st 0.708171206 Ia
Pt000712 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt000711 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt000710 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt000709 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt039357 not found in 424aa AT1G76900.2 not_not 0.700389105 III
Pt037559 not found in 416aa AT2G18280.2 not_not 0.526588845 III
Pt037558 not found in 416aa AT2G18280.2 not_not 0.526588845 III
Pt041132 not found in 392aa AT2G47900.2 not_not 0.525291828 III
Pt001717 not found in 416aa AT1G47270.1 not_not 0.525291828 III
Pt037730 not found in 416aa AT1G47270.1 not_not 0.520103761 III
Pt034249 not found in 395aa AT2G47900.2 not_not 0.517509727 III
Pt001281 not found in 414aa AT2G18280.2 not_not 0.499351491 III
Pt028965 not found in 377aa AT1G53320.1 not_not 0.412451361 III
Pt025486 not found in 379aa AT1G53320.1 not_not 0.411154345 III
Pp034735 not found in 483aa AT2G47900.2 1st_not 0.549935149 II
Pp034734 not found in 483aa AT2G47900.2 not_not 0.549935149 III
Pp000633 not found in 474aa AT2G47900.2 not_not 0.544747081 III
Pp022947 not found in 435aa AT2G47900.2 not_not 0.544747081 III
Pp034759 not found in 428aa AT2G47900.2 not_not 0.543450064 III
Pp022942 not found in 447aa AT2G47900.2 not_not 0.540856031 III
Pp005711 not found in 407aa AT2G47900.2 not_not 0.531776913 III
Sm012016 ATSTYHLCLGLSPNFD in 155/430 AT2G47900.2 1st_not 0.539559014 II
Sm008088 not found in 357aa AT2G47900.2 not_not 0.531776913 III
Sm016835 not found in 432aa AT2G47900.2 not_not 0.514915693 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G25280.1     ------------------------------------------------------------
pp034735_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRS-------GS
gm041730_Glyma1 ------------------------------------------------------------
Sm016835_Selmo1 ---------------------------------------------MSGKKS--------S
gm044675_Glyma1 ------------------------------------------------------------
Sb024300_Sorbi1 --AEEC------------------------SCGGGG---GF--WRVGGRER------QAS
pp022942_Pp1s22 ------------------------------------------------------------
pt000709_POPTR_ ------------------------------------------------------------
pt041132_POPTR_ ------------------------------------------------------------
Os021774_Os05t0 ------------------------------------------------------------
Os022386_Os05t0 ------------------------------------------------------------
pt001717_POPTR_ ------------------------------------------------------------
pt039357_POPTR_ ------------------------------------------------------------
Os009468_Os02t0 ------------------------------------------------------------
Os021773_Os05t0 ------------------------------------------------------------
gm021742_Glyma0 ------------------------------------------------------------
gm030081_Glyma1 ------------------------------------------------------------
pt037558_POPTR_ ------------------------------------------------------------
Sb030332_Sorbi1 ------------------------------------------------------------
Os029490_Os07t0 ------------------------------------------------------------
Sb031457_Sorbi1 ------------------------------------------------------------
gm003396_Glyma0 ------------------------------------------------------------
pp034759_Pp1s15 ------------------------------------------------------------
pt002868_POPTR_ ------------------------------------------------------------
Sb014893_Sorbi1 ------------------------------------------------------------
gm045746_Glyma1 ------------------------------------------------------------
gm044959_Glyma1 ------------------------------------------------------------
gm039266_Glyma1 ------------------------------------------------------------
gm028526_Glyma1 ------------------------------------------------------------
pt025486_POPTR_ ------------------------------------------------------------
pp005711_Pp1s21 ------------------------------------------------------------
gm044960_Glyma1 ------------------------------------------------------------
pt037559_POPTR_ ------------------------------------------------------------
gm048089_Glyma1 ------------------------------------------------------------
gm036752_Glyma1 ------------------------------------------------------------
Sb032660_Sorbi1 -----------------------------------------------------------L
pt028965_POPTR_ ------------------------------------------------------------
pp022947_Pp1s22 ------------------------------------------------------------
Sm012016_Selmo1 ---------------------------------------------MSGKKSS-----SSS
gm045744_Glyma1 ------------------------------------------------------------
gm021740_Glyma0 ------------------------------------------------------------
pt000711_POPTR_ ------------------------------------------------------------
pt000710_POPTR_ ------------------------------------------------------------
gm045745_Glyma1 ------------------------------------------------------------
gm021741_Glyma0 ------------------------------------------------------------
gm041219_Glyma1 ------------------------------------------------------------
gm003133_Glyma0 ------------------------------------------------------------
Os037720_Os11t0 ------------------------------------------------------------
Os019651_Os04t0 ------------------------------------------------------------
gm037352_Glyma1 ------------------------------------------------------------
gm039265_Glyma1 ------------------------------------------------------------
gm003395_Glyma0 ------------------------------------------------------------
Sb026173_Sorbi1 ------------------------------------------------------------
pt034249_POPTR_ ------------------------------------------------------------
gm054929_Glyma2 ------------------------------------------------------------
Os029803_Os08t0 ------------------------------------------------------------
Os019649_Os04t0 ------------------------------------------------------------
pt001281_POPTR_ ------------------------------------------------------------
Os004869_Os01t0 ------------------------------------------------------------
gm001764_Glyma0 ------------------------------------------------------------
gm004126_Glyma0 ------------------------------------------------------------
Os022387_Os05t0 ------------------------------------------------------------
pt037730_POPTR_ ------------------------------------------------------------
pp000633_Pp1s10 MLASECLTVHGLRRWLKLWLILLKRSLEGIWCEVSRRELGFCKWTMSGQKS--------S
Os029491_Os07t0 ------------------------------------------------------------
gm034540_Glyma1 ------------------------------------------------------------
Sb028483_Sorbi1 ------------------------------------------------------------
gm030080_Glyma1 ------------------------------------------------------------
pt000712_POPTR_ ------------------------------------------------------------
Os040209_Os12t0 ------------------------------------------------------------
Os009471_Os02t0 ------------------------------------------------------------
Sm008088_Selmo1 ------------------------------------------------------------
gm036751_Glyma1 ------------------------------------------------------------
Sb027814_Sorbi1 ------------------------------------------------------------
gm019438_Glyma0 ------------------------------------------------------------
gm003397_Glyma0 ------------------------------------------------------------
gm021743_Glyma0 ------------------------------------------------------------
pp034734_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRS-------GS
Sb032884_Sorbi1 ---------------------------------------------IFGAVSSPFFFPLSF
gm028527_Glyma1 ------------------------------------------------------------
gm054928_Glyma2 ------------------------------------------------------------
                                                                            

AT1G25280.1     --MSF-------------------------------RG---IV---QDLRDGFGSLSRR-
pp034735_Pp1s15 SMMPL-------------------------------KS---LIREFQEMKGGRGGISRR-
gm041730_Glyma1 -MCLI-------------------------------RS---M------------------
Sm016835_Selmo1 TLTPL-------------------------------WS---VI---QDIK-GIGSISRR-
gm044675_Glyma1 --MSL-------------------------------RS---IVRELKEMRDGIGSTSKR-
Sb024300_Sorbi1 GDMPF-------------------------------SS---MI---HEMKGEIGAISSR-
pp022942_Pp1s22 --MPL-------------------------------KS---LIREFQEMKGGIGNISRR-
pt000709_POPTR_ --MSF-------------------------------RS---IV---RDMRDGFGSLSRR-
pt041132_POPTR_ -MSAI-------------------------------KS---II-----------------
Os021774_Os05t0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
Os022386_Os05t0 -----------------------------------------MALW-RCSSSWLSSVSRSS
pt001717_POPTR_ --MSF-------------------------------KS------KLKEIRDDITTTFSMG
pt039357_POPTR_ --MSF-------------------------------RS---IV---RDMRDGFGSLSRR-
Os009468_Os02t0 --MSL-------------------------------KS---IVRELREMRDGIGSMSRR-
Os021773_Os05t0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
gm021742_Glyma0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
gm030081_Glyma1 --MSL-------------------------------KS---IVRELKEMRDGIGSMSRR-
pt037558_POPTR_ --MSI-------------------------------KS---IVRELKEMKDGIGNISRR-
Sb030332_Sorbi1 ------------------------------------------------------------
Os029490_Os07t0 --MSF-------------------------------RS---VI---QEVKGEIGAISRR-
Sb031457_Sorbi1 ------------------------------------------------------------
gm003396_Glyma0 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
pp034759_Pp1s15 --MPL-------------------------------KS---LIREFQEMKGGRGGISRR-
pt002868_POPTR_ --MSF-------------------------------RS---IV---RDMRDGFGSLSRR-
Sb014893_Sorbi1 --MSF-------------------------------RS---MV---RDIRESFGNISRR-
gm045746_Glyma1 -MIEV-------------------------------QA---N------------------
gm044959_Glyma1 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
gm039266_Glyma1 --MPF-------------------------------RS---IVRELKEIGEGISNMYRR-
gm028526_Glyma1 --MSF-------------------------------RS---IV---REVRDGFGSLSRR-
pt025486_POPTR_ --MSL-------------------------------RR---SILS-RRFSRSFNNQNRNE
pp005711_Pp1s21 ------------------------------------------------MKSGVGRISRR-
gm044960_Glyma1 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
pt037559_POPTR_ --MSI-------------------------------KS---IVRELKEMKDGIGNISRR-
gm048089_Glyma1 --MPF-------------------------------RS---IVRELKEIGEGISNMYRR-
gm036752_Glyma1 ------------------------------------------------------------
Sb032660_Sorbi1 AKMSF-------------------------------RS---IV---RDVRDSFGSLSRR-
pt028965_POPTR_ --MSL-------------------------------RR---SFLS-RRFSRSFNNQNRNE
pp022947_Pp1s22 ------------------------------------------------MKGGIGNISRR-
Sm012016_Selmo1 SLLPL-------------------------------RS---ILREFQDIRDGIGSLSRR-
gm045744_Glyma1 -MIEV-------------------------------QA---N------------------
gm021740_Glyma0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
pt000711_POPTR_ --MSF-------------------------------RS---IV---RDMRDGFGSLSRR-
pt000710_POPTR_ --MSF-------------------------------RS---IV---RDMRDGFGSLSRR-
gm045745_Glyma1 -MIEV-------------------------------QA---N------------------
gm021741_Glyma0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
gm041219_Glyma1 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
gm003133_Glyma0 --MSL-------------------------------RS---IVRELKEMRDGIGSTSKR-
Os037720_Os11t0 ------------------------------------------------------------
Os019651_Os04t0 --MSF-------------------------------RS---IV---RDFRDSFGTLSKR-
gm037352_Glyma1 --MSL-------------------------------RK---VFRS-RKFSRSFKEVLPAE
gm039265_Glyma1 --MPF-------------------------------RS---IVRELKEIGEGISNMYRR-
gm003395_Glyma0 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
Sb026173_Sorbi1 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
pt034249_POPTR_ -MPAL-------------------------------KS---II-----------------
gm054929_Glyma2 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
Os029803_Os08t0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
Os019649_Os04t0 --MSF-------------------------------RS---IV---RDFRDSFGTLSKR-
pt001281_POPTR_ --MSF-------------------------------KS---IMREFKEIKEGIGSISRR-
Os004869_Os01t0 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
gm001764_Glyma0 --MSL-------------------------------KS---IVRELKEMRDGIGSMSRR-
gm004126_Glyma0 --MSF-------------------------------RS---II---LE---------RK-
Os022387_Os05t0 -----------------------------------------MALW-RCSSSWLSSVSRSS
pt037730_POPTR_ --MSF-------------------------------KG------KLKEIRDDISTTFSMG
pp000633_Pp1s10 SMMPL-------------------------------KS---LIREFQEMKGGIGNISRR-
Os029491_Os07t0 --MSF-------------------------------RS---VI---QEVKGEIGAISRR-
gm034540_Glyma1 --MSL-------------------------------RK---VFRS-RKFSKSFKEVLPAE
Sb028483_Sorbi1 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
gm030080_Glyma1 --MSL-------------------------------KS---IVRELKEMRDGIGSMSRR-
pt000712_POPTR_ --MSF-------------------------------RS---IV---RDMRDGFGSLSRR-
Os040209_Os12t0 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
Os009471_Os02t0 ------------------------------------------------MRDGIGSMSRR-
Sm008088_Selmo1 -------------------------------------------------------MSR--
gm036751_Glyma1 -MGLI-------------------------------RS---M------------------
Sb027814_Sorbi1 AAMSL-------------------------------KS---IVRELKEMRDGIGSMSRRG
gm019438_Glyma0 ------------------------------------------------------------
gm003397_Glyma0 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
gm021743_Glyma0 --MSF-------------------------------RS---IV---RDVRDSFGSLSRR-
pp034734_Pp1s15 SMMPL-------------------------------KS---LIREFQEMKGGRGGISRR-
Sb032884_Sorbi1 SFLSLASLPCSLPPPAPFIPPSARANLFRGRAGIGARRPPVMISW-RRSASWLSSASRSS
gm028527_Glyma1 --MSF-------------------------------RS---IV---REVRDGFGSLSRR-
gm054928_Glyma2 --MSF-------------------------------RS---IV---RDVRDGFGSLSRR-
                                                                            

AT1G25280.1     -----SFDFR-------LSSL------HKGKA-QGSSFREYSS-------SRDLLSPVIV
pp034735_Pp1s15 -----SFELK-------FPHH------HKGRS-SG---MVLD--------ESQLRVEAVV
gm041730_Glyma1 ----------------------------RSQS-QR---VVQEQEEAE---C----VGDSM
Sm016835_Selmo1 -----SFEVK-------LPTY------SRSRS-HS---AAQDAAGRHQFGESG-------
gm044675_Glyma1 -----GAESKHWL--------------SRTKS-HVAPDILATPFEPIQQ-GQ--------
Sb024300_Sorbi1 -----GL-LRFR-----SGGHA----AAAGRA-SAAA-----------E------PDEAL
pp022942_Pp1s22 -----SFELK-------FPHH------HKGRS-SG---MVLD--------ESQLRAEPVV
pt000709_POPTR_ -----SFEVR-------LPGH------FRGKS-HGSACELLD-------------QPVVI
pt041132_POPTR_ ---------------------------NRSRS-HR---VVQYSSAPD---LSLFGGGCGA
Os021774_Os05t0 -----SFEVTLAGL-SGLTGH------HRGKS-QSTVHELCD-------------ADLII
Os022386_Os05t0 -GGVGGGESKVSPEIAPVSGGEGEGEEEEGEE----------------------------
pt001717_POPTR_ -----KLQRNRTN--------------RRGRA-YIAPEL--------GG-GSELLSELIE
pt039357_POPTR_ -----SFEVR-------LPGH------LRGKS-HGSACELQD-------------QPVVI
Os009468_Os02t0 -----AADGRAGG--------------GRGGSRHSWPVLWSEQQQPPQQ-QQLQRQEHQQ
Os021773_Os05t0 -----SFEVTLAGL-SGLTGH------HRGKS-QSTVHELCD-------------ADLII
gm021742_Glyma0 -----SFDVR-------LTGH------HRGKS-QGSVQDLHD-------------QPLVI
gm030081_Glyma1 -----GVESRRWN--------------GRTKS-HVAPDVTLTSLEPIQQ-GH--------
pt037558_POPTR_ -----GLEGKHWR--------------GRARS-HIAPDETPAETDQIEQ-GQ--------
Sb030332_Sorbi1 ------------------------------------------------------------
Os029490_Os07t0 -----GF---------------------RSRP-GRVRRVAAAAEEPP---DESSAAALVM
Sb031457_Sorbi1 ------------------------------------------------------------
gm003396_Glyma0 -----SFDVR-------ISGG--------GKL-NSLVHEAHE-------------RQLVI
pp034759_Pp1s15 -----SFELK-------FPHH------HKGRS-SG---MVLD--------ESQLRVEAVV
pt002868_POPTR_ -----SFEVR-------LPGH------HRGKS-HSSACELHD-------------QPVVI
Sb014893_Sorbi1 -----NFEVRI---------H------HRGKS-LGSSSDLQD-------------KPAEI
gm045746_Glyma1 ----------------------------------------------------------AM
gm044959_Glyma1 -----SFDVR-------LSGG--------GKS-NSLVHEEHE-------------CLPVV
gm039266_Glyma1 -----GGEAKHVH--------------RHGKS-HIAPECSLPPPPPPPP-SSSS------
gm028526_Glyma1 -----SFEVR-------LPGH------NRGKS-RSLVHELQD-------------QPPVI
pt025486_POPTR_ RNAV---ESGRLGG------------ELWAES----------------------------
pp005711_Pp1s21 -----SFELK-------FPHH------HRGRS-SG---MVLD--------ESQLNSEPVV
gm044960_Glyma1 -----SFDVR-------LSGG--------GKS-NSLVHEEHE-------------CLPVV
pt037559_POPTR_ -----GLEGKHWR--------------GRARS-HIAPDETPAETDQIEQ-GQ--------
gm048089_Glyma1 -----GGEAKHVH--------------RHGKS-HIAPECSLPPPPSSSS-SSSSSS---S
gm036752_Glyma1 ------------------------------------------------------------
Sb032660_Sorbi1 -----SFEVTIAGL-SGLTVH------HRGKS-QSTVHEVCD-------------TDLII
pt028965_POPTR_ RNGV---ESGRLVG------------ESGGES----------------------------
pp022947_Pp1s22 -----SFELK-------FPHH------HKGRS-SG---MVLD--------ESQLRAEPVV
Sm012016_Selmo1 -----SFEVR-------LPYH------HRSRS-HS---VVLD--------EPPVRDVVVL
gm045744_Glyma1 ----------------------------------------------------------AM
gm021740_Glyma0 -----SFDVR-------LTGH------HRGKS-QGSVQDLHD-------------QPLVI
pt000711_POPTR_ -----SFEVR-------LPGH------FRGKS-HGSACELLD-------------QPVVI
pt000710_POPTR_ -----SFEVR-------LPGH------FRGKS-HGSACELLD-------------QPVVI
gm045745_Glyma1 ----------------------------------------------------------AM
gm021741_Glyma0 -----SFDVR-------LTGH------HRGKS-QGSVQDLHD-------------QPLVI
gm041219_Glyma1 -----SFDVR-------LTGH------HRGKS-QGSVQDLHD-------------QPLVI
gm003133_Glyma0 -----GAESKHRL--------------SRTKS-HVAPDVLATPFEPIQQ-GQ--------
Os037720_Os11t0 ------------------------------------------------------------
Os019651_Os04t0 -----SFEVKIS----GFSGR------HRGKS-IGPSSELDD-------------TPVVA
gm037352_Glyma1 GAAIVGGEDGVAGAGE---------ESSNG-N----------------------------
gm039265_Glyma1 -----GGEAKHVH--------------RHGKS-HIAPECSLPPPPPPPP-SSSS------
gm003395_Glyma0 -----SFDVR-------ISGG--------GKL-NSLVHEAHE-------------RQLVI
Sb026173_Sorbi1 -----SFEVTLASI-YGLTGH------HKGKT-QSSLHELDD-------------SPSII
pt034249_POPTR_ ---------------------------NRSTS-HR---VVQYSSAPE---LNLFAAGGAA
gm054929_Glyma2 -----SFEVR-------LPGH------NRGKS-RSSVHELQD-------------QPPVI
Os029803_Os08t0 -----SFEVRISGL-PGLSGH------HRGKS-LGSLSELRD-------------RPVVV
Os019649_Os04t0 -----SFEVKIS----GFSGR------HRGKS-IGPSSELDD-------------TPVVA
pt001281_POPTR_ -----GVEGKHWC--------------GRVRS-HIAPDETREETDQIDQ-GQ--------
Os004869_Os01t0 -----SFEVTLASL-YGLTGH------HKGKT-QSSLDELDD-------------SPAII
gm001764_Glyma0 -----GVESRRWN--------------GRTKS-HVAPDVILTSLEPIQQ-GQ--------
gm004126_Glyma0 -----GFEVK-------FGYSM----RSRSQS-HSD-AIAQDS----------LVVLDGL
Os022387_Os05t0 -GGVGGGESKVSPEIAPVSGGEGEGEEEEGEE----------------------------
pt037730_POPTR_ -----KLQRNRTN--------------RRGRA-YIAPEL--------GG-GSELFRELIE
pp000633_Pp1s10 -----SFELK-------FPHH------HRGRS-SG---MVLD--------ESQLRPERVV
Os029491_Os07t0 -----GF---------------------RSRP-GRVRRVAAAAEEPP---DESSAAALVM
gm034540_Glyma1 GAAV---EGGVAGTVE---------EAANGNN----------------------------
Sb028483_Sorbi1 -----GFEVR-------FLSP------RRGKS-HGAVHELHD-------------PVPVV
gm030080_Glyma1 -----GVESRRWN--------------GRTKS-HVAPDVTLTSLEPIQQ-GH--------
pt000712_POPTR_ -----SFEVR-------LPGH------FRGKS-HGSACELLD-------------QPVVI
Os040209_Os12t0 -----GFEVR-------LVGH------RRGRS-HSAVHELRDG-------HAAAAAADVV
Os009471_Os02t0 -----AADGRAGG--------------GRGGSRHSWPVLWSEQQQPPQQ-QQLQRQEHQQ
Sm008088_Selmo1 ------------------------------------------------------------
gm036751_Glyma1 ----------------------------RSRS-QR---VVQEQEAAE---CVGVVVGDSM
Sb027814_Sorbi1 G---SGSDGRAGH--------------GRSGSRHSWPSLWAEQQQPQRQ-GQEGPQHQHQ
gm019438_Glyma0 -----------------------------------------------------------M
gm003397_Glyma0 -----SFDVR-------ISGG--------GKL-NSLVHEAHE-------------RQLVI
gm021743_Glyma0 -----SFDVR-------LTGH------HRGKS-QGSVQDLHD-------------QPLVI
pp034734_Pp1s15 -----SFELK-------FPHH------HKGRS-SG---MVLD--------ESQLRVEAVV
Sb032884_Sorbi1 LGAAVGGEAKVTPEVDPAAAQEME-EDEEADE----------------------------
gm028527_Glyma1 -----SFEVR-------LPGH------NRGKS-RSLVHELQD-------------QPPVI
gm054928_Glyma2 -----SFEVR-------LPGH------NRGKS-RSSVHELQD-------------QPPVI
                                                                            

AT1G25280.1     QT-SRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSW-RAMCQEIVL-GPEIC
pp034735_Pp1s15 KQ-SCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSW-REITKELVR-TPEQS
gm041730_Glyma1 RQ-SCWANMPQELLREVLFRIEASEDAWPPRKSVVACAGVCRSW-RQITIDIVK-TPELS
Sm016835_Selmo1 QQ-SRWANMPPELLRDVIQRVEASDKMWPSRKSVVACAAVCRNW-RKITKEIVQ-TLEQC
gm044675_Glyma1 -----WANLPSELLLDIIQRIEESETSWPARAVVVFCASVCKSW-RSITREIVK-TPEQC
Sb024300_Sorbi1 RE-SCWARVPPELLRMVLARVEHEEARWPGRSAVVASAGVCRCW-RAVVKEMVR-VPEVS
pp022942_Pp1s22 EQ-SCWANMPPELLRDVIQRVEASENAWPSRKHVVACAAVCSSW-REITKELVR-TPEQS
pt000709_POPTR_ QD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REMCKEIVR-SPEFS
pt041132_POPTR_ ETTSCWANLPQELLREVLIRIEESESSWPPRKNVVACAGVCRSW-RDITKELVK-VPELS
Os021774_Os05t0 QE-SRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAW-REMCKEIVL-SPEFC
Os022386_Os05t0 ---ERWSRLLPELLTEIMRRVDAGAERWPPRRDVVACACVCRRW-RDAAVSVVR-PPLEC
pt001717_POPTR_ EQ-SPWANLPPELLQDVIKRVEGSETSWPGRRDVVACASVCTSW-REITKAVVK-TPEQC
pt039357_POPTR_ QN-SRWAGLPPELLQDVIKRLEASESTWPSRKHVVACASVCRAW-REMCKEIVR-SPEFS
Os009468_Os02t0 QQ-GRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSW-REVTKEVVK-TLEEC
Os021773_Os05t0 QE-SRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAW-REMCKEIVL-SPEFC
gm021742_Glyma0 QN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC
gm030081_Glyma1 -----WANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAVTKEIVK-TPEQC
pt037558_POPTR_ -----WANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSW-REITKEIVK-TPEQC
Sb030332_Sorbi1 ------------------------------------------------------------
Os029490_Os07t0 RE-SCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSW-RGIVREIVR-TPEAS
Sb031457_Sorbi1 ------------------------------------------------------------
gm003396_Glyma0 QN-SRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REMCKEIVT-SPEFC
pp034759_Pp1s15 KQ-SCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSW-REITKELVR-TPEQS
pt002868_POPTR_ QN-SRWAGLPPELLRDVIKRLEASESTWPARKHVVACAAVCSAW-REMCKEIVR-NPEFS
Sb014893_Sorbi1 QQ-SRWASLPPELLRDVMKRLEEDDSSWPDRKDVVCCASVCTTW-RDMCKDIVR-SPEHC
gm045746_Glyma1 EQ-SWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLIVKEIVK-PPQFS
gm044959_Glyma1 QN-SRWASLPPELLRDVIKRLEESETTWPARKHVVACAAVCRSW-RGMCKEIVT-SPEFC
gm039266_Glyma1 -Q-SRWANLPPELLLDIIQRLEASETSWPARRALVACASVCRLW-REITKDVIK-TPEQC
gm028526_Glyma1 QN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC
pt025486_POPTR_ ---DGWGSMLPELLGEIIKRVEESEDRWPQRQSVVACACVCKKW-RDVTKDIVKSLPNSS
pp005711_Pp1s21 EQ-SCWANMPPELLRDVIQRVEASESAWPSRKHVVACAAVCSSW-REVTKELVR-APEQS
gm044960_Glyma1 QN-SRWASLPPELLRDVIKRLEESETTWPARKHVVACAAVCRSW-RGMCKEIVT-SPEFC
pt037559_POPTR_ -----WANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSW-REITKEIVK-TPEQC
gm048089_Glyma1 WQ-SRWANLPPELLLDIIQRLEASETSWPARRALVACASVCKLW-REITKDVVK-TPEQC
gm036752_Glyma1 ------------------------------------------------------------
Sb032660_Sorbi1 QE-SRWANLPPELLRDVIRRLEASESTWPNRKHVVSCAAVCRAW-REMCREIVL-SPEFC
pt028965_POPTR_ ---DGWGSMLPELLGEIIKRVEESEDRWPQRQNVVACACVCKKW-REVTKDIVKSLPNNN
pp022947_Pp1s22 EQ-SCWANMPPELLRDVIQRVEASENAWPSRKHVVACAAVCSSW-REITKELVR-TPEQS
Sm012016_Selmo1 QQ-SRWASMPPELLRDVIQRLESSEHTWPARKNVVVCAEVCSQW-RDIAKELVK-TPEQS
gm045744_Glyma1 EQ-SWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLIVKEIVK-PPQFS
gm021740_Glyma0 QN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC
pt000711_POPTR_ QD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REMCKEIVR-SPEFS
pt000710_POPTR_ QD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REMCKEIVR-SPEFS
gm045745_Glyma1 EQ-SWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLIVKEIVK-PPQFS
gm021741_Glyma0 QN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC
gm041219_Glyma1 QN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC
gm003133_Glyma0 -----WANLPSELLLDIIQRVEESETSWPARAVVVFCASVCKSW-RSITREIVK-TPEQC
Os037720_Os11t0 ------------------------------------------------------------
Os019651_Os04t0 QQ-SKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTW-RDMCKDIVR-NPEFC
gm037352_Glyma1 ---NGWSNMLPEILGEIVRRVDAAEEQWPNRQNVVACACVCKRW-RDITREVVR-VPSHT
gm039265_Glyma1 -Q-SRWANLPPELLLDIIQRLEASETSWPARRALVACASVCRLW-REITKDVIK-TPEQC
gm003395_Glyma0 QN-SRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REMCKEIVT-SPEFC
Sb026173_Sorbi1 RE-SRWANLPPELIRDIIRRLEADESTWPARKHVVCFAAVCRTW-REMCKEIVL-SPELC
pt034249_POPTR_ ETASCWANLPQELLREVLVRIEESESSWPPRKNVVACAGVCRSW-RHITKDLVK-VPELS
gm054929_Glyma2 QN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC
Os029803_Os08t0 DQ-SRWVGLPPELLRDVMKRLEEGESNWPSRKDVVACAAVCRTW-REICKDIVQ-SPEIC
Os019649_Os04t0 QQ-SKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTW-RDMCKDIVR-NPEFC
pt001281_POPTR_ -----WANLPPELLLDIIMRLEESESSWPARVVVVHCASVCRSW-REITKEIVK-TPEQC
Os004869_Os01t0 PE-SRWASLPPELLREVIRRLEADESTWPSRRNVVCFAAVCRTW-REMCKETVL-SPEFC
gm001764_Glyma0 -----WANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAVTKEIVK-TPEQC
gm004126_Glyma0 KQ-SCWANMPPELLRDVLMRIEASEDSWPAQKHVVACAGVCRSW-REIMKEIVK-SPQLS
Os022387_Os05t0 ---ERWSRLLPELLTEIMRRVDAGAERWPPRRDVVACACVCRRW-RDAAVSVVR-PPLEC
pt037730_POPTR_ EQ-SPWANLPPELLHDVIQRVEGSETSWPGRRDVVACASVCKSW-REITKTVVK-TPEQC
pp000633_Pp1s10 EQ-SCWANMPPELLRDVIQRVEVSESTWPSRKHVVACAAVCSSW-REITKELVR-TPEQS
Os029491_Os07t0 RE-SCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSW-RGIVREIVR-TPEAS
gm034540_Glyma1 ---NGWSSMLPEILGEIVRRVDAAEEQWPNRQNVVACACVCKRW-RDITREVVR-VPSHT
Sb028483_Sorbi1 QS-SCWASLPPELLRDVIERLETSEDTWPSRKHVVACAAVCRTW-REMCREIVK-SPEVS
gm030080_Glyma1 -----WANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAVTKEIVK-TPEQC
pt000712_POPTR_ QD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REMCKEIVR-SPEFS
Os040209_Os12t0 QS-SCWANLPPELLRDVIERLEASEAAWPSRKNVVACAAVCRTW-RDMCREIVK-NPEFC
Os009471_Os02t0 QQ-GRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSW-REVTKEVVK-TLEEC
Sm008088_Selmo1 -Q-SCWANMPPELLRDIIQRLESSDNVWPSRKNVVACAAVCSTW-REITKELVK-SPELS
gm036751_Glyma1 RQ-SCWANMPQELLREVLLRIEASEDTWPPRKSVVSCAGVCRSW-RHITKDIVK-TPELS
Sb027814_Sorbi1 HQ-GRWANLPPELLLDVIQRVESSEATWPARRQVVACAAVCRSW-REVTKEVVK-TLEEC
gm019438_Glyma0 EQ-SWRANMPRELLREVLLRIESSEATWPSRRSVVACGGVCRTW-RLIVKEIVK-PPQLS
gm003397_Glyma0 QN-SRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REMCKEIVT-SPEFC
gm021743_Glyma0 QN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC
pp034734_Pp1s15 KQ-SCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSW-REITKELVR-TPEQS
Sb032884_Sorbi1 ---ERWSRLLPELLTEIMRRVDAGAERWPPRRDVVVCACVCRRW-RDAAVSVVR-PPLEC
gm028527_Glyma1 QN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC
gm054928_Glyma2 QN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC
                                                                            

AT1G25280.1     --------GKLTFPVSLKQPGPRDA--MIQCFIKRDKSKLTFHLFLCLSPAL---L-VEN
pp034735_Pp1s15 --------GRLTFPIALKQPGPRES--TVQCFIKRDRTSSTYQLYLGLPPS----L-VEN
gm041730_Glyma1 --------SKITFPISVKQPGPREN--LLRCFIKRNRSSQTYYLYLSLTNT----L-AED
Sm016835_Selmo1 --------GRLTFPVSLKQPGPRDA--TVQCYLKRDRTTSTYYLYLGITPS--KPS-KKN
gm044675_Glyma1 --------GRITFPISLKQPGPRDS--PIQCFIRRNKETSTYLLYFGLVPS-----ENDG
Sb024300_Sorbi1 --------GKITFPISLKQPGPRDA--PMKCFIRRNRATQSYSLCIGITDA----L-ADD
pp022942_Pp1s22 --------GRLTFPIALKQPGPRDS--TMQCFIKRDRTTSTYQLFLGLPPS----L-VEN
pt000709_POPTR_ --------GKITFPVSLKQPGPRDG--TVQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
pt041132_POPTR_ --------GKLTFPISVKQPGPRDF--LLQCFIKRCRSAQTYRLYLGLNNA----L-TED
Os021774_Os05t0 --------GKLTFPLSLKQPGPRDG--MIQCFIKRDKSKSTYHLYLCLSTAV---L-ADS
Os022386_Os05t0 --------GRITFPSSLKQPGPRDA--PMHCFIRRNKKNSTFYLYLSLTQA----L-TDK
pt001717_POPTR_ --------GCITFPISLKQPGPRDA--PIQCFIKRERATSTYHLYLGLSPA----LSGDM
pt039357_POPTR_ --------GKITFPVSLKQPGSRDG--TIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
Os009468_Os02t0 --------GRITFPISLKQPGPREH--PVQCFVRRDRATSTYLLYLGLSPS----LHGEN
Os021773_Os05t0 --------GKLTFPLSLKQPGPRDG--MIQCFIKRDKSKSTYHLYLCLSTAV---L-ADS
gm021742_Glyma0 --------GKLTFPVSLKQPGPRDG--IIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
gm030081_Glyma1 --------GRLTFPISLKQPGPRDS--PIQCFIRRNRETSTYLLYIGLVPS-----ENET
pt037558_POPTR_ --------GRLTFPISLKQPGHRES--PIQCFIKRDTATSTFLLYYGLVPS-----EGEN
Sb030332_Sorbi1 --------------------------------------------------AV---L-SED
Os029490_Os07t0 --------GNLTFPISLKQPGPRDA--PMKCFIVRNRTTQTYYLYIGLTDA----L-TDD
Sb031457_Sorbi1 --------------------------------------------------AV---L-VES
gm003396_Glyma0 --------GKITFPVSLKQPGSRDG--TIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
pp034759_Pp1s15 --------GRLTFPIALKQPGPREN--TVQCFIKRDRTTSTYQLFLGLPPT----L-VEN
pt002868_POPTR_ --------GKITFPVSLKQPGPRDG--TIQCFIKRDKSKLTYHLFLCLSPAL---L-VEN
Sb014893_Sorbi1 --------AKLTFPISLKQPGPRDG--VIQCFIKRDKSKLTYRLYLSLSSAV---L-DEN
gm045746_Glyma1 --------SNITFPISLKQPGPREH--LLQCFIRRNSASQTYYLFLSLSSA----LVADD
gm044959_Glyma1 --------GKITFPVSLKQPGSRDG--TIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
gm039266_Glyma1 --------GLLTFPISLKQPGPRDS--PIQCFIRRERMTSTYCLYLGLSPA----LSGDM
gm028526_Glyma1 --------GKITFPVSLKQPGHRDG--PIQCFIKRDKSKLTYHLFLGLSPAL---L-VEN
pt025486_POPTR_ SSTNNASPGKITFPSCLKQPGPRDL--PHQCLIKRNKKTSTFYLYLALTPS----F-MDK
pp005711_Pp1s21 --------GRLTFPVALKQPGPRED--TVQCFIKRDRTTSTYQLFLGLPPS----Q--EN
gm044960_Glyma1 --------GKITFPVSLKQPGSRDG--TIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
pt037559_POPTR_ --------GRLTFPISLKQPGHRES--PIQCFIKRDTATSTFLLYYGLVPS-----EGEN
gm048089_Glyma1 --------GFITFPISLKQPGPRDS--PIQCFIRRERMTSTYCLYLGLSPA----LSGDM
gm036752_Glyma1 ------------------MPGPREN--LLRCFIKRNRSTQTYYLFLSLTST----L-AED
Sb032660_Sorbi1 --------GKLTFPVSLKQPGPRDG--MIQCFIKRDKSKSTYHLYLCLSTAV---L-MEN
pt028965_POPTR_ N--NNGSSGKITFPSCLKQPGPRDL--PHQCLIKRNKKTSTFYLYLALTPS----F-TDK
pp022947_Pp1s22 --------GRLTFPIALKQPGPREN--TVQCFIKRDRTTSTYQLFLGLPPS----L-VEN
Sm012016_Selmo1 --------GKLTFPISLKQPGPRDA--TMQCFIKRDRATSTYHLCLGLSPNFDAGL-QEH
gm045744_Glyma1 --------SNITFPISLKQPGPREH--LLQCFIRRNSASQTYYLFLSLSSA----LVADD
gm021740_Glyma0 --------GKLTFPVSLKQPGPRDG--IIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
pt000711_POPTR_ --------GKITFPVSLKQPGPRDG--TVQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
pt000710_POPTR_ --------GKITFPVSLKQPGPRDG--TVQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
gm045745_Glyma1 --------SNITFPISLKQPGPREH--LLQCFIRRNSASQTYYLFLSLSSA----LVADD
gm021741_Glyma0 --------GKLTFPVSLKQPGPRDG--IIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
gm041219_Glyma1 --------GKLTFPVSLKQPGPRDG--IIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
gm003133_Glyma0 --------GRITFPISLKQPGPRDS--PIQCFIRRNKETSTYLLYFGLVPS-----ENDS
Os037720_Os11t0 ----------------------------MQCFIRRDKSTQTYYLYLSLGSAV---L-VDN
Os019651_Os04t0 --------GKLTFPVSLKQPGPRDG--VIQCFIKRDKSKLTYHLYLCLSSAV---L-DET
gm037352_Glyma1 --------GKITFPACLKQPGPRDV--PHQCLIKRNKKTSTFYLYLALTPS----F-TDK
gm039265_Glyma1 --------GLLTFPISLKQPGPRDS--PIQCFIRRERMTSTYCLYLGLSPA----LSGDM
gm003395_Glyma0 --------GKITFPVSLKQPGSRDG--TIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
Sb026173_Sorbi1 --------GKLTFPVSLKQPGPRDGNTMIQCFIKRNKSKSTYYLYLCLSNVV---T-SES
pt034249_POPTR_ --------GKITFPISVKQPGPREQ--LLQCFIKRCRSTQTYRLYLSLNNA----L-TED
gm054929_Glyma2 --------GKITFPVSLKQPGHRDG--PIQCFIKRDKSKLTYHLFLCLSPAL---L-VEN
Os029803_Os08t0 --------GKLTFPVSLKQPGPRDG--LIQCFIKRDKSKLTYYLYLCLSPAV---L-SEN
Os019649_Os04t0 --------GKLTFPVSLKQPGPRDG--VIQCFIKRDKSKLTYHLYLCLSSAV---L-DET
pt001281_POPTR_ --------GRLTFPISLKQPGPRES--PIQCFIKRDNATSTFLLYYGLVPS-----GGEN
Os004869_Os01t0 --------GKLTFPVSIKQPGPRDG--MIQCYIKRNRSKSTYHLYLCLSNVV---T-AEG
gm001764_Glyma0 --------GRLTFPISLKQPGPRDS--PIQCFIRRNRETSTYLLYIGLVPS-----ENET
gm004126_Glyma0 --------GKLTFPISLKQPGPRDS--LLQCYIKRNRSNQTYYLFLGLNQA----S-TDE
Os022387_Os05t0 --------GRITFPSSLKQPGPRDA--PMHCFIRRNKKNSTFYLYLSLTQA----L-TDK
pt037730_POPTR_ --------GCITFPISLKQPGPRDA--PIQCFIKRERATSTYLLYLGLSPA----LSGDM
pp000633_Pp1s10 --------GRLTFPIALKQPGPREN--TVQCFIKRDRTTSTYQLFLGLPPS----L-IEN
Os029491_Os07t0 --------GNLTFPISLKQPGPRDA--PMKCFIVRNRTTQTYYLYIGLTDA----L-TDD
gm034540_Glyma1 --------GKITFPSCLKQPGPRDV--PHQCLIKRNQKTSTFYLYLALTPS----F-TDK
Sb028483_Sorbi1 --------GKITFPVSLKQPGPRDG--TIQCFIKRDKSTQVYSLYLSFSSAV---P-AED
gm030080_Glyma1 --------GRLTFPISLKQPGPRDS--PIQCFIRRNRETSTYLLYIGLVPS-----ENET
pt000712_POPTR_ --------GKITFPVSLKQPGPRDG--TVQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
Os040209_Os12t0 --------GKITFPVSLKQPGPRNG--AIQCFIKRDKSTQTYNLYLCLSSAV---L-VES
Os009471_Os02t0 --------GRITFPISLKQPGPREH--PVQCFVRRDRATSTYLLYLGLSPS----LHGEN
Sm008088_Selmo1 --------GKLTFPVSLKQPGPRDA--TVQCYIERDRTTATYRLFLGLTPT----L-TEN
gm036751_Glyma1 --------SKITFPISVKQPGPREN--LLRCFIKRNRSTQTYYLFLSLTST----L-AED
Sb027814_Sorbi1 --------GRITFPISLKQPGPRDL--PVQCFVRRERATSTYLLYLGLSPS----MNMEN
gm019438_Glyma0 --------SNITFPISLKQPGPREH--LLQCFIRRNSATQTYYLFLSLSSA----LIADD
gm003397_Glyma0 --------GKITFPVSLKQPGSRDG--TIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
gm021743_Glyma0 --------GKLTFPVSLKQPGPRDG--IIQCFIKRDKSNLTYHLFLCLSPAL---L-VEN
pp034734_Pp1s15 --------GRLTFPIALKQPGPRES--TVQCFIKRDRTSSTYQLYLGLPPS----L-VEN
Sb032884_Sorbi1 --------GRITFPSSLKQPGPRDA--PMHCFIRRDKKNSTFSLYLSLTQA----L-TDK
gm028527_Glyma1 --------GKITFPVSLKQPGHRDG--PIQCFIKRDKSKLTYHLFLGLSPAL---L-VEN
gm054928_Glyma2 --------GKITFPVSLKQPGHRDG--PIQCFIKRDKSKLTYHLFLCLSPAL---L-VEN
                                                                          . 

AT1G25280.1     GKFLLSAKRTRRTTRTEYIISMDADNISRSS--NSYLGKL--------------------
pp034735_Pp1s15 GKFLLAARKFRRAASTDYIISLNQEDISRGS--NTYVGKL--------------------
gm041730_Glyma1 GKFLLAARKCRRPTCTDYIISLDADDMSKGS--NSYVGKL--------------------
Sm016835_Selmo1 GKFLLAARKFRRASGTDYIISTDTDDFSRGS--NTYVGKL--------------------
gm044675_Glyma1 NKLLLAAKRIRRATGTDFIISLAADDFSRAS--NKYVGKL--------------------
Sb024300_Sorbi1 GKFLLAARRSRRPAGTEYLISLDAKNTSKGTC----IGKL--------------------
pp022942_Pp1s22 GKFLLAARKCRRATSTDYIVSLNHEDMSRGS--NTYVGKL--------------------
pt000709_POPTR_ GKFLLSAKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------
pt041132_POPTR_ GKFLLAARKCRRPTCTDYIISLDTDDMSKGS--NAYVGKL--------------------
Os021774_Os05t0 GKFLLSAKRHRKTTCTEYVISMDADNISRSS--STYIGKL--------------------
Os022386_Os05t0 GKFLLAARRFRNGAHTEYIISYDCDDLFPGS--NSYVGKL--------------------
pt001717_POPTR_ SKLLLAAKKIRKATSTDFRISFVGSDFCQTS--NTYAGKL--------------------
pt039357_POPTR_ GKFLLSAKRKRRTACTEYVISMDADNVSRSS--STYIGKL--------------------
Os009468_Os02t0 DKLLLAARKIRRATRTSFVISLVSNDFSLSS--STYVGKL--------------------
Os021773_Os05t0 GKFLLSAKRHRKTTCTEYVISMDADNISRSS--STYIGKL--------------------
gm021742_Glyma0 GKFLLSAKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------
gm030081_Glyma1 DKLLLAAKKVRRATGTDFIISLVADDFSRSS--NTYVGKL--------------------
pt037558_POPTR_ DKLLLAARKIRRATCSDFIVSLVSDDFSRAS--NTYVGKL--------------------
Sb030332_Sorbi1 GKFLLAAKRNRRTTYTEYIISVDRKNISRSS--NGYVGKM--------------------
Os029490_Os07t0 GKFLLAARKCRRTTCTEYLISLDMNDISKRT--DSYVGKL--------------------
Sb031457_Sorbi1 GKFLLCAKRTSRPTCTEYTIFMNSENLSRSS--KMYIGKL--------------------
gm003396_Glyma0 GKFLLSAKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------
pp034759_Pp1s15 GKFLLAAKKFRRPTRTDYIISLNHDDMSRGG--TAYVGKL--------------------
pt002868_POPTR_ GKFLLSAKRTRRTTCTEYVISMDADNISRSS--STYIGKL--------------------
Sb014893_Sorbi1 GKFLLAAKRSRRMAHTEYAIFMGSRNFSRSS--TGYIGKL--------------------
gm045746_Glyma1 GKFLLAARKFRRPTCTDYIISLDADDMSRES--NAYVGKL--------------------
gm044959_Glyma1 GKFLLSAKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------
gm039266_Glyma1 SKLLLAAKKIRRATCTEFIISLVADDFSRAC--DTYVGKL--------------------
gm028526_Glyma1 GKFLLSAKRTRRTTCTEYVISMDADNISRSS--STYIGKL--------------------
pt025486_POPTR_ GKFLLAARRYRQGAHTEYIISLDADELSQGS--NAYVGKL--------------------
pp005711_Pp1s21 GKFLLAAQKFRRATSTDYIISLNQEDMSRGS--STYVGKL--------------------
gm044960_Glyma1 GKFLLSAKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------
pt037559_POPTR_ DKLLLAARKIRRATCSDFIVSLVSDDFSRAS--NTYVGKL--------------------
gm048089_Glyma1 SKLLLAAKKIRRATCTEFIISLVSDDFSWAS--NTYVGKL--------------------
gm036752_Glyma1 GKFLLAARKCRRPTCTDYIISLDADDMSKGS--NSYVGKL--------------------
Sb032660_Sorbi1 GKFLLSAKRNRKTTCTEYVISMDAENISRSS--STYIGKL--------------------
pt028965_POPTR_ GKFLLAARRYRQGVHTEYIISLDADDLSQGS--NAYVGKL--------------------
pp022947_Pp1s22 GKFLLAARKFRRATSTDYIISLNQENMSRGS--NTYVGKL--------------------
Sm012016_Selmo1 GKFLLAARKVRRATTTDYIISLDPEDFSRGS--TSYVGKL--------------------
gm045744_Glyma1 GKFLLAARKFRRPTCTDYIISLDADDMSRES--NAYVGKLRSTLNQILLLAILLFLFLSA
gm021740_Glyma0 GKFLLSAKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------
pt000711_POPTR_ GKFLLSAKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------
pt000710_POPTR_ GKFLLSAKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------
gm045745_Glyma1 GKFLLAARKFRRPTCTDYIISLDADDMSRES--NAYVGKL--------------------
gm021741_Glyma0 GKFLLSAKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------
gm041219_Glyma1 GKFLLSAKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------
gm003133_Glyma0 NKLLLAAKRIRRATGTGFVISLAADDFSRAS--NKYVGKL--------------------
Os037720_Os11t0 GKFLLSAKRNWHATCTEYVISMNANNLSRST--NTNIGKL--------------------
Os019651_Os04t0 GKFLLSAKRSRRTTHTDYIISMDSKNISRSS--SGYIGKL--------------------
gm037352_Glyma1 GKFLLAARRYRCGTHTEYIISLDADDLSQGS--NAYVGKL--------------------
gm039265_Glyma1 SKLLLAAKKIRRATCTEFIISLVADDFSRAC--DTYVGKL--------------------
gm003395_Glyma0 GKFLLSAKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------
Sb026173_Sorbi1 GKFLLSAKRHRKTTCTEYTISMDSGNISRSS--RTYIGKI--------------------
pt034249_POPTR_ GKFLLAARKCRRPTCTDYIISLDTDDMSKGS--NTYAGKL--------------------
gm054929_Glyma2 GKFLLSAKRTRRTTCTEYIISMDADNISRSS--STYIGKL--------------------
Os029803_Os08t0 GKFLLAAKRNRRATSTEYIISVDSKNISRSS--NGYVGKM--------------------
Os019649_Os04t0 GKFLLSAKRSRRTTHTDYIISMDSKNISRSS--SGYIGKL--------------------
pt001281_POPTR_ DKLLLAARKIRRATCTDFIVSLVSDDFSRAS--NTYVGKL--------------------
Os004869_Os01t0 GKFVLAAKRHRKTTCTEYTISMVSGNISRSS--RTNIGKL--------------------
gm001764_Glyma0 DKLLLAAKKVRRATGTDFVISLVADDFFRSS--NTYVGKL--------------------
gm004126_Glyma0 GKFLLSARKCRRATHTDYIISLNCDDVSRGS--STYIGKL--------------------
Os022387_Os05t0 GKFLLAARRFRNGAHTEYIISYDCDDLFPGS--NSYVGKL--------------------
pt037730_POPTR_ NKVLLAAKKIRKATSTDFRISFAGSDFCQTS--NTYVGKL--------------------
pp000633_Pp1s10 GKFLLAARKFRRATSTDYIISLNQEDMSRGS--NTYVGKL--------------------
Os029491_Os07t0 GKFLLAARKCRRTTCTEYLISLDMNDISKRT--DSYVGKL--------------------
gm034540_Glyma1 GKFLLAARRYRCGTHTEYIISLDADDLSQGS--NAYVGKL--------------------
Sb028483_Sorbi1 GKFLLSAKRNCRPTYTEYTISINSGDISRSTSNNTYIGKL--------------------
gm030080_Glyma1 DKLLLAAKKVRRATGTDFIISLVADDFSRSS--NTYVGKL--------------------
pt000712_POPTR_ GKFLLSAKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------
Os040209_Os12t0 GKFLLSAKRYSRATCTEYTIFMSADNTSRSS--NMYIGKL--------------------
Os009471_Os02t0 DKLLLAARKIRRATRTSFVISLVSNDFSLSS--STYVGKL--------------------
Sm008088_Selmo1 GKFLLAARKSRRATSTDYIISIDPEDMSRGS--SSCVGKL--------------------
gm036751_Glyma1 GKFLLAARKCRRPTCTDYIISLDADDMSKGS--NSYVGKL--------------------
Sb027814_Sorbi1 DKLLLAARKVRRATRTSFVISLVSDDFSHSS--STYVGKL--------------------
gm019438_Glyma0 GKFLLAARKFRRPTCIDYIISLDADDMSRES--NAYVGKL--------------------
gm003397_Glyma0 GKFLLSAKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------
gm021743_Glyma0 GKFLLSAKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------
pp034734_Pp1s15 GKFLLAARKFRRAASTDYIISLNQEDISRGS--NTYVGKL--------------------
Sb032884_Sorbi1 GKFLLAARRFRQGAHTEYIISYDYDDLHPRS--SSYVGKL--------------------
gm028527_Glyma1 GKFLLSAKRTRRTTCTEYVISMDADNISRSS--STYIGKL--------------------
gm054928_Glyma2 GKFLLSAKRTRRTTCTEYIISMDADNISRSS--STYIGKL--------------------
                .*.:*.*::        : :     :           **:                    

AT1G25280.1     ----------RSNFLGTKFLVYDTQPPPNTSSSALIT-DRTSRSR-FHSRR-VS--P-KV
pp034735_Pp1s15 ----------RSNFLGTKFTIYDSQPSHNGVAAS----NRGAW-R-MGTKQ-LS--S-RV
gm041730_Glyma1 ----------RSNFLGTKFTIYDGQPPHAGAKIMK---SRSTR-L-VNLKQ-VS--P-KV
Sm016835_Selmo1 ----------RSNFMGTKFTLYDSNPPHDGAVAST---NRAGR-R-ILSKQ-VS--P-RV
gm044675_Glyma1 ----------RSNFLGTKFTIFDSQAPNDVAIQP--N-CQSSR-R-FHSKQ-VS--P-RL
Sb024300_Sorbi1 ----------RSNFLGTKFTVYDAHPPCTGAVVSK---GPSAH-M-IGSAQ-VS--P-GV
pp022942_Pp1s22 ----------RSNFLGTKFTIYDSQPPHSGVVAS----NRGTR-R-LGSKQ-LT--S-RV
pt000709_POPTR_ ----------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSR-R-FYSKK-VS--P-KV
pt041132_POPTR_ ----------RSNFLGTKFTVFDGQPPHAGAKMTK---SRSSR-L-VNLKQ-VS--P-RV
Os021774_Os05t0 ----------RSNFLGTKFIIYDTQPSYNGAVIPPVG--RSSR-R-FNSKK-VS--P-KM
Os022386_Os05t0 ----------RSDFLGTKFIIYDSQPPYDGAKPSR---SQSSR-R-FASKQ-IN--P-NV
pt001717_POPTR_ ----------RSNFLGTKFTIYDSQPPCPGLKS---N-CKLQQ-K-VRSIQ-VS--P-GV
pt039357_POPTR_ ----------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSR-R-FYSKK-VS--P-KV
Os009468_Os02t0 ----------KPNFLGTKFTIFDSQPPCDAVVLP--N-NRPSK-R--HFKQ-VS--P-RL
Os021773_Os05t0 ----------RSNFLGTKFIIYDTQPSYNGAVIPPVG--RSSR-R-FNSKK-VS--P-KM
gm021742_Glyma0 ----------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-R-FYSKK-VS--P-KV
gm030081_Glyma1 ----------RSNFLGTKFTIYDSQPPHGAAIQP--D-SQPSR-R-FHSKQ-VS--P-RV
pt037558_POPTR_ ----------RSNFLGTKFTMYDCEPTFEVPTQTQHA-NRISR-R-FHSRQ-VS--P-RL
Sb030332_Sorbi1 ----------RSNFLGTKFVVYDTQTPHNAGSLLSCE--RGSR-R-ISSRR-VS--P-KV
Os029490_Os07t0 ----------RSNFLGTKFTIYDAHPPYAGDVISK---GQSAR-V-IGSNH-LS--P-RI
Sb031457_Sorbi1 ----------RSNLLGTKFAIYDTQPPCNT---SQPG--KTSR-R-FYSRK-VS--P-KV
gm003396_Glyma0 ----------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-R-FYSKK-VS--P-KV
pp034759_Pp1s15 ----------RSNFLGTKFTIYDSQPSHNGVAAS----NRGAW-R-MGTKQ-LS--S-RV
pt002868_POPTR_ ----------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-R-FYSKK-VS--P-KV
Sb014893_Sorbi1 ----------RSNFLGTKFIIYDTQPPYNAGKLCAQE-RAPSR-R-LSSRK-VS--P-RV
gm045746_Glyma1 ----------RSNFLGTKFTIYD----------RK---SCSTE-LVVNSKQ-VSPRP-RV
gm044959_Glyma1 ----------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-R-FYSKK-VS--P-KV
gm039266_Glyma1 ----------RSNFLGTKFTILDGEPPHDSSLPL--N-CKLQQ-R-VHLKQ-VL--PNKV
gm028526_Glyma1 ----------RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSR-R-F-SKK-VS--P-KV
pt025486_POPTR_ ----------SSDFLGTNFTIFDSQPPHSGAKPSS---SRASR-R-FASKQ-IS--P-QV
pp005711_Pp1s21 ----------RSNFLGTKFTIYDSQPPQNGPVLS----NRSSR-R-LTSKQ-LS--Y-RA
gm044960_Glyma1 ----------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-R-FYSKK-VS--P-KV
pt037559_POPTR_ ----------RSNFLGTKFTMYDCEPTFEVPTQTQHA-NRISR-R-FHSRQ-VS--P-RL
gm048089_Glyma1 ----------RSNFLGTKFTILDGEPAHETSLPL--N-CKLQQ-R-VHLKQ-VL--PNKV
gm036752_Glyma1 ----------RSNFLGTKFTIYDSQLPHTGAKIMK---SRSTR-L-VNLKQ-VS--P-KV
Sb032660_Sorbi1 ----------RSNFLGTKFMISDTQPPYNGAVVPHAG--RTSR-R-FNSKK-VS--P-KV
pt028965_POPTR_ ----------SSDFLGTNFTIYDSQPPHSGAKPSS---SRASR-R-FASKQ-IS--P-QV
pp022947_Pp1s22 ----------RSNFLGTKFTIYDSQPPHSGVVAS----NRGTR-R-MGSKQ-LT--S-RV
Sm012016_Selmo1 ----------RSNFLGTKFTIYDSQPPHVGAMPSN---SRVGR-R-FGSKQ-IS--P-RV
gm045744_Glyma1 KTNPLSSHFIRSNFLGTKFTIYD----------RK---SCSTE-LVVNSKQ-VSPRP-RV
gm021740_Glyma0 ----------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-R-FYSKK-VS--P-KV
pt000711_POPTR_ ----------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSR-R-FYSKK-VS--P-KV
pt000710_POPTR_ ----------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSR-R-FYSKK-VS--P-KV
gm045745_Glyma1 ----------RSNFLGTKFTIYD----------RK---SCSTE-LVVNSKQ-VSPRP-RV
gm021741_Glyma0 ----------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-R-FYSKK-VS--P-KV
gm041219_Glyma1 ----------RSNFLGTKFIIYDTQPPYSSAHICPPGTGKTSR-R-FYSKK-VS--P-KV
gm003133_Glyma0 ----------RSNFLGTKFTVYDSQAPHDSAIQS--N-CQSSR-R-FHSKQ-VS--P-RV
Os037720_Os11t0 ----------RSNFLGTKFVIYDTHTPYNATSDSQSG--KTSR-R-FSNKG--T--A-KH
Os019651_Os04t0 ----------RSNFLGTKFIIYDTQPPYNARTLCSQE--RTSR-R-FSSRK-VS--P-KV
gm037352_Glyma1 ----------SSDFLGTNFTIYDSQPPHSGAKPSS---GRASR-R-FASKQ-IS--P-QV
gm039265_Glyma1 ----------RSNFLGTKFTILDGEPPHDSSLPL--N-CKLQQ-R-VHLKQ-VL--PNKV
gm003395_Glyma0 ----------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-R-FYSKK-VS--P-KV
Sb026173_Sorbi1 ----------RSNFLGTRFLIYDTQPPYNGAVVPPSG--RTSR-R-FNSTK-VS--P-KL
pt034249_POPTR_ ----------RSNFLGTKFTVFDGQPPHAGAKMTK---SYSSR-L-VNLKQ-VS--P-RV
gm054929_Glyma2 ----------RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSR-R-F-SKK-VS--P-KV
Os029803_Os08t0 ----------RSNFLGTKFVVYDTQPPYNAGSLMSCQ--HGSR-R-ISSRR-VS--P-KL
Os019649_Os04t0 ----------RSNFLGTKFIIYDTQPPYNARTLCSQE--RTSR-R-FSSRK-VS--P-KV
pt001281_POPTR_ ----------RSNFLGTKFTMYDSEPTFEVPRQL--A-SRTSR-R-FNPRQ-VS--L-RL
Os004869_Os01t0 ----------RSNFLGTKFIIYDTQPPYNGAVVPHVG--RTSK-R-FNSTK-VS--P-KV
gm001764_Glyma0 ----------RSNFLGTKFTIYDSQPPQGAAIQP--D-NRSSR-R-FHSKQ-VS--P-RV
gm004126_Glyma0 ----------RSNFLGTKFTVYDAHPPIYGAKVTK---SRSTR-L-VSLKQ-VS--P-RV
Os022387_Os05t0 ----------RSDFLGTKFIIYDSQPPYDGAKPSR---SQSSR-R-FASKQ-IN--P-NV
pt037730_POPTR_ ----------RSNFLGTKFTIYDGQTPCPAMRS---N-CKPQR-K-VRSIQ-VS--P-GV
pp000633_Pp1s10 ----------RSNFLGTKFTIYDSQPPHNRGVAS----NRSSR-R-IGSKQ-LT--S-RV
Os029491_Os07t0 ----------RSNFLGTKFTIYDAHPPYAGDVISK---GQSAR-V-IGSNH-LS--P-RI
gm034540_Glyma1 ----------SSDFLGTNFTIYDSQPPHSGAKPSS---GRASR-R-FASKQ-IS--P-QV
Sb028483_Sorbi1 ----------RSNFLGTKFVIYDTQPPYNATSPTVAG--KTNQ-R-FYSKKGGS--T-KG
gm030080_Glyma1 ----------RSNFLGTKFTIYDSQPPHGAAIQP--D-SQPSR-R-FHSKQ-VS--P-RV
pt000712_POPTR_ ----------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSR-R-FYSKK-VS--P-KV
Os040209_Os12t0 ----------RSNLLGTKFVIYDTQPPCNTANVSQSG--KTSR-R-FYSRK-VS--P-KN
Os009471_Os02t0 ----------KPNFLGTKFTIFDSQPPCDAVVLP--N-NRPSK-R--HFKQ-VS--P-RL
Sm008088_Selmo1 ----------RSNFLGTKFAIYDTQPPHSGAIAST---NRAGR-R-VAAKQ-VS--P-KV
gm036751_Glyma1 ----------RSNFLGTKFTIYDSQLPHTGAKIMK---SRSTR-L-VNLKQ-VS--P-KV
Sb027814_Sorbi1 ----------KPNFLGTKFTIFDSQPPPDAVVLP--N-NKPSK-R--QSKQ-VS--P-RL
gm019438_Glyma0 ----------RSNFLGTKFTIYDIPLPHVGAKMTK---SCFTK-L-VNPKQ-VS--P-RV
gm003397_Glyma0 ----------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-R-FYSKK-VS--P-KV
gm021743_Glyma0 ----------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-R-FYSKK-VS--P-KV
pp034734_Pp1s15 ----------RSNFLGTKFTIYDSQPSHNGVAAS----NRGAW-R-MGTKQ-LS--S-RV
Sb032884_Sorbi1 ----------RSDFLGTKFIIYDSQAPYDGAKPSR---SRSTR-R-FASKQ-IS--P-QV
gm028527_Glyma1 ----------RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSR-R-F-SKK-VS--P-KV
gm054928_Glyma2 ----------RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSR-R-F-SKK-VS--P-KV
                           .:::**.* : *                                     

AT1G25280.1     -PSGSYNIAQITYELNVLGTRGP------RRMHCIMNSIPISS-LEP---GGS---VPNQ
pp034735_Pp1s15 -HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACA-MES---GGS---APTP
gm041730_Glyma1 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPAAA-IEP---GGV---APVQ
Sm016835_Selmo1 -PAGSYNIAHIAYELNVLGTRGP------RRMECTIHSIPASA-MEP---GGC---APTP
gm044675_Glyma1 -PACNYLVSTVSYELNVLCTRGP------RRMYCVMNSIPVSA-IQE---GGN---APTP
Sb024300_Sorbi1 -PAGNYPISHISYEAT-FGSRYP------RKMNCVMDSIPLSA-IKE---GGT---APTQ
pp022942_Pp1s22 -HCGSHNVAHIAYELNVLGTRGP------RRMQCTMHSIPASA-MAS---GGS---APTP
pt000709_POPTR_ -PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSS-LEP---GGS---VPGQ
pt041132_POPTR_ -PTGNYPVASISYELNVLGSRGP------RRMHCIMDAIPASA-IEP---GGI---APTQ
Os021774_Os05t0 -PSGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASS-VEP---GGI---VPGQ
Os022386_Os05t0 -SGGNYEVGQVSYKFNFLKSRGP------RRMQCNIQC-PVGQ--------STA------
pt001717_POPTR_ -PARNFNVATVSYELNVLRTRGP------RRMHCIVHSIPISA-IQE---GGV---APTP
pt039357_POPTR_ -PTGSYNIAQVTYELNVLGTRGP------RRMHCTMHSIPALS-LEP---GGS---VPGQ
Os009468_Os02t0 -PLGNYNVATVSYELTVLRNRGP------RRMQCTMHSIPALC-IQE---GGK---APTP
Os021773_Os05t0 -PSGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASS-VEP---GGI---VPGQ
gm021742_Glyma0 -PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASA-LDA---GGT---VPGQ
gm030081_Glyma1 -PACNYVVSTIAYELNVLRARGP------RRMHCTMNSIPVSA-VQA---GGN---APTP
pt037558_POPTR_ -PACNYSIGTITYELNVLRSRGP------RRMHCMMHSIPMSS-IEE---GGT---VPTL
Sb030332_Sorbi1 -PTASYPIARVNYELNLLGTRGP------RRMNCTMHSIPASA-LDP---EGM---VPGQ
Os029490_Os07t0 -PAGNYPVSHISYELNVLGSRGP------RRMHCAMDSIPVSA-IEQ---GGT---APTQ
Sb031457_Sorbi1 -SSRTYNIAQVSYELNVLGTRGP------RRMNCVMHSIPASC-LEA---GGT---VPCQ
gm003396_Glyma0 -PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSA-LEP---GCT---VPGQ
pp034759_Pp1s15 -HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACA-MES---GGS---APTP
pt002868_POPTR_ -PTGSYNIAQVTYELNVLGTRGP------RRMHCTMHSIPASS-LEP---GGS---VPGQ
Sb014893_Sorbi1 -PTGSYPIAQVNYKLNVLGTRGP------RRMQSAMHSIPASA-LEP---GGV---VPGQ
gm045746_Glyma1 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASA-IEP---GGVAVAAPSQ
gm044959_Glyma1 -PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSA-LEP---GCT---VPGQ
gm039266_Glyma1 -SAANYKVATVSYELNVLRTRGP------RRMRCMMHLIPISA-IQE---GGN---APTP
gm028526_Glyma1 -PSGSYNIAQVTYELNVLGTRGP------RRMNCTMYSIPASS-MEP---NGV---VPGQ
pt025486_POPTR_ -PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVLQ--------ETI------
pp005711_Pp1s21 -HAGSFNVAHIAYELNVLGTRGP------RRMQCTLHGIPLST-MES---VGS---APSP
gm044960_Glyma1 -PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSA-LEP---GCT---VPGQ
pt037559_POPTR_ -PACNYSIGTITYELNVLRSRGP------RRMHCMMHSIPMSS-IEE---GGT---VPTL
gm048089_Glyma1 AAAANYKVATRSKANAVYDALNPHICNPRRRER--------------------------P
gm036752_Glyma1 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPATA-IEP---GGV---APTQ
Sb032660_Sorbi1 -PTGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASA-VEP---GGI---VPGQ
pt028965_POPTR_ -PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVSQ--------ETT------
pp022947_Pp1s22 -HCGSYNVAHIAYELNVLGTRGP------RRMQCTMHSIPASA-MAS---GGS---APTP
Sm012016_Selmo1 -PSGSYNVAHIAYELNVLGTRGP------RRMQVTIHSIPASA-MDP---GGV---APTP
gm045744_Glyma1 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASA-IEP---GGVAVAAPSQ
gm021740_Glyma0 -PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASA-LDA---GGT---VPGQ
pt000711_POPTR_ -PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSS-LEP---GGS---VPGQ
pt000710_POPTR_ -PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSS-LEP---GGS---VPGQ
gm045745_Glyma1 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASA-IEP---GGVAVAAPSQ
gm021741_Glyma0 -PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASA-LDA---GGT---VPGQ
gm041219_Glyma1 -PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASA-LDA---GGT---VPGQ
gm003133_Glyma0 -PACSYLVSTVSYELNVLCTRGP------RRMHCVMNSIPVSA-IQE---GGN---APTP
Os037720_Os11t0 -PCSTYSIANISYELNVFGTRGP------RRMCCLMHSIPASS-LEA---GGT---VPSQ
Os019651_Os04t0 -PTGCYPIVQVNYELNVLGTRGP------RRMQCAMHSIPASA-VEP---GGI---VPGQ
gm037352_Glyma1 -PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVTPVVSP--SVESS------
gm039265_Glyma1 -SAANYKVATVSYELNVLRTRGP------RRMRCMMHLIPISA-IQE---GGN---APTP
gm003395_Glyma0 -PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSA-LEP---GCT---VPGQ
Sb026173_Sorbi1 -PSVSYNIAQVSYELNVLGTRGP------RRMRCIMHSIPASS-VEP---GGI---VPGQ
pt034249_POPTR_ -PTGNYPVANISYELNVLGSRGP------RRMHCIMDAIPAAA-IEP---GGV---APTQ
gm054929_Glyma2 -PSGSYNIAHVTYELNVLGTRGP------RRMNCTMYSIPASS-MEP---NGI---VPGQ
Os029803_Os08t0 -PTGSYPIAHVKYELNVLGTRGP------RRMQCTMHSIPASA-VDP---EGV---VPGQ
Os019649_Os04t0 -PTGCYPIVQVNYELNVLGTRGP------RRMQCAMHSIPASA-VEP---GGI---VPGQ
pt001281_POPTR_ -PACNYCIATITYELNVLRSRGP------RRMHCIMHSIPMSS-IEE---GGT---VQTL
Os004869_Os01t0 -PSVTYNIAQVSYELNVLGTRGP------RRMRCMMHSIPASS-VEP---GGI---VPGQ
gm001764_Glyma0 -PACNYVVSTIAYELNVLRARGP------RRMHCTMNSISVSA-VQE---GGN---APTP
gm004126_Glyma0 -PAGNYPIAHVSYDLNVLGSRGP------RIMQCVMDAIPASA-VEP---GGV---APTQ
Os022387_Os05t0 -SGGNYEVGQVSYKFNFLKSRGP------RRMQCNIQC-PVGQ--------STA------
pt037730_POPTR_ -AARNYNVATVSYELNVLRTRGP------RRMHCTIHSIPISA-IQE---GGI---APTP
pp000633_Pp1s10 -HAGSYNVAHIAYELNVLGTRGP------RRMQCMLHTIPMSA-MES---GGS---APTP
Os029491_Os07t0 -PAGNYPVSHISYELNVLGSRGP------RRMHCAMDSIPVSA-IEQ---GGT---APTQ
gm034540_Glyma1 -PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVTP-VSP--TSGSS------
Sb028483_Sorbi1 -SCSRYSIGQVSYELNVLGTRGP------RRMNCVMHSIPASC-LEA---GGS---VPCQ
gm030080_Glyma1 -PACNYVVSTIAYELNVLRARGP------RRMHCTMNSIPVSA-VQA---GGN---APTP
pt000712_POPTR_ -PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSS-LEP---GGS---VPGQ
Os040209_Os12t0 -PSSTYSIAQVSYELNVLGTRGP------RRMNCVMHSIPASS-LEA---GGT---VPCQ
Os009471_Os02t0 -PLGNYNVATVSYELTVLRNRGP------RRMQCTMHSIPALC-IQE---GGK---APTP
Sm008088_Selmo1 -PAGSYNVAHISYELNVLGTRGP------RRMQCTLHAVGAVS-MDSDSEGMA---VPAS
gm036751_Glyma1 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPATA-IEP---GGV---APTQ
Sb027814_Sorbi1 -PLGNYNVATVTYELTVLRNRGP------RRMQCTMHSIPAEC-IQE---GGK---APTP
gm019438_Glyma0 -PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASA-IEP---GGVAV-APSQ
gm003397_Glyma0 -PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSA-LEP---GCT---VPGQ
gm021743_Glyma0 -PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASA-LDA---GGT---VPGQ
pp034734_Pp1s15 -HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACA-MES---GGS---APTP
Sb032884_Sorbi1 -SGGNFEVGQVTYKFNFMKSRGP------RRMQCNIQC-PVSQ--------GTM------
gm028527_Glyma1 -PSGSYNIAQVTYELNVLGTRGP------RRMNCTMYSIPASS-MEP---NGV---VPGQ
gm054928_Glyma2 -PSGSYNIAHVTYELNVLGTRGP------RRMNCTMYSIPASS-MEP---NGI---VPGQ
                     . :              *      *                              

AT1G25280.1     PEKL-VPAPYSL-DD----SFRSN--ISFSKS---------S-FDHRS-----LDFSSSR
pp034735_Pp1s15 TE---LAAG-SL-EE-VHVPYSSIMSSPRSKA---------AVVDSS-------ALESSE
gm041730_Glyma1 TE---FSLN-NI-DMFPSFPF------FRSKS---------N------------RVENSV
Sm016835_Selmo1 LE---S-AT-SM-DE-ASMLPPLLLPVGAKSS---------KVAALD-------GLEGLE
gm044675_Glyma1 AS---YPQ--IF-DE----HFSPS-PALKEKV------------------P-VTDLNSAS
Sb024300_Sorbi1 TE---FPSI-------NSNSFASV--PFFRKS-------------------GRLDSSGVQ
pp022942_Pp1s22 TE---FTSC-GL-EE-AHVPYSSILLSPRSKA---------AVVDSS-------ALESSE
pt000709_POPTR_ PE-L-LPC--SL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
pt041132_POPTR_ TE---FSHH-NV-DFLPSLPF------FRSKS---------N------------RVESFQ
Os021774_Os05t0 PEQI-VPR--AF-EE----SFRST--TSFSKS---------SIMDRSMDFSSSRDFSSAR
Os022386_Os05t0 -------------SD-----------------------------------P---------
pt001717_POPTR_ LE---FNN--PG-DE----QSPSL-SASKVKQ------------------P-LIDFISTS
pt039357_POPTR_ PE-L-LPR--CL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
Os009468_Os02t0 TG---IIH--SL-DE----QVPAL-STSKGKE------------------P-AIEFSSTS
Os021773_Os05t0 PEQI-VPR--AF-EE----SFRST--TSFSKS---------SIMDRSMDFSSSRDFSSAR
gm021742_Glyma0 PE-L-LPR--PL-ED----SFRSI---SFSKS-----------LDRSI------EFSSSR
gm030081_Glyma1 T----FPE--II-DE----PFSPS-PALKGKG------------------P-IRDLDNAS
pt037558_POPTR_ TS---LTE--TF-GG----QFPHL-STSKGKE------------------S-VSDISSPS
Sb030332_Sorbi1 PKQLFIPGSSSF-GE----SFRSA--NTSSSS-------RFSVTDRSL------DFSSSR
Os029490_Os07t0 TE---FPLS-YH-ESFTSIPF------FKSKS---------V------------RANNS-
Sb031457_Sorbi1 PDSI-LAR--SI-DE----SFGSI---SFSKS---------SVVDHSM------RFSSTR
gm003396_Glyma0 PE-L-LPR--SL-ED----SFRSI---SFARS-----------IDNST------EFSSSR
pp034759_Pp1s15 TE---LAAG-SL-EE-VHVPYSSIMSSPRSKA---------AVVDSS-------ALESSE
pt002868_POPTR_ AE-L-LPR--SL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
Sb014893_Sorbi1 SKEL-LPR--LF-DE----SFSSTA-TSFSKY---------SVVDSSM------DLISCR
gm045746_Glyma1 TD---FSVS-NR-D--TSFPF------FQTNS---------T------------SLENSI
gm044959_Glyma1 PE-L-LPR--SL-ED----SFRSI---SFARS-----------IDNST------EFSSSR
gm039266_Glyma1 LK---FTN--YLNDY----ASTTI-PDTKGKK------------------PEVVEFDSTG
gm028526_Glyma1 PE-L-LPR--AL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
pt025486_POPTR_ -------------ND-----------------------------------K---ILDNSK
pp005711_Pp1s21 TE---VTAD-SL-ER-AHVPHSGVMSSSRSKA---------AVVDIS-------TLD-YD
gm044960_Glyma1 PE-L-LPR--SL-ED----SFRSI---SFARS-----------IDNST------EFSSSR
pt037559_POPTR_ TS---LTE--TF-GG----QFPHL-STSKGKE------------------S-VSDISSPS
gm048089_Glyma1 YS---F-------EH----ASTTT-PDSKGKK------------------PEVVEFDSTG
gm036752_Glyma1 TE---FSLN-NI-DMFPSFPF------FRSKS---------N------------RAENSM
Sb032660_Sorbi1 PEQI-LPR--AL-EE----SFRST--TSFSKS---------SIMDRSMDFSSSRDFSSAR
pt028965_POPTR_ -------------NV-----------------------------------K---NVDNSK
pp022947_Pp1s22 TE---FTSC-GL-EE-AHVPYSSILLSPRSKA---------AVVDSS-------ALESSE
Sm012016_Selmo1 TV---F-AN-PL-ED-AQLPF------PVSKS---------KVSDCS-------TAPVVV
gm045744_Glyma1 TD---FSVS-NR-D--TSFPF------FQTNS---------T------------SLENSI
gm021740_Glyma0 PE-L-LPR--PL-ED----SFRSI---SFSKS-----------LDRSI------EFSSSR
pt000711_POPTR_ PE-L-LPC--SL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
pt000710_POPTR_ PE-L-LPC--SL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
gm045745_Glyma1 TD---FSVS-NR-D--TSFPF------FQTNS---------T------------SLENSI
gm021741_Glyma0 PE-L-LPR--PL-ED----SFRSI---SFSKS-----------LDRSI------EFSSSR
gm041219_Glyma1 PE-L-LPR--SL-ED----SFRSI---SFSKS-----------LDHSI------EFSSSR
gm003133_Glyma0 TS---FPQ--IF-DE----PFSPS-PALKEKA------------------Q-VTDLNSAS
Os037720_Os11t0 PDSI-LAH--SL-NE---SSFRSV---SFSKS---------SVMDHSM------HFSSAQ
Os019651_Os04t0 PKEL-LPR--LF-EE----SFRSM--AT-SFS-------KYSITDHST------DFSSSR
gm037352_Glyma1 -------------DS-----------------------------------T---PVNGHK
gm039265_Glyma1 LK---FTN--YLNDY----ASTTI-PDTKGKK------------------PEVVEFDSTG
gm003395_Glyma0 PE-L-LPR--SL-ED----SFRSI---SFARS-----------IDNST------EFSSSR
Sb026173_Sorbi1 PEQI-VPR--AL-ED----SFRST--ASFSQSFRSTTSLSKSIMDSSM------DFNSAR
pt034249_POPTR_ TE---FYHH-SA-DFFPSLLF------FRSKS---------NRV--E-------RVESFQ
gm054929_Glyma2 PE-L-LPR--AL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
Os029803_Os08t0 PEQL-LPG--PF-EE----SFRST--NT--SS-------RFSFMDRSL------DFSSSR
Os019649_Os04t0 PKEL-LPR--LF-EE----SFRSM--AT-SFS-------KYSITDHST------DFSSSR
pt001281_POPTR_ TS---IPE--AF-NG----QFPHL-SSSIGKE------------------L-VSDNSSAS
Os004869_Os01t0 PEQI-VPR--AL-ED----SFRST--TSFSQSFRSTTSFSKSIMDPSM------DFSSAR
gm001764_Glyma0 TS---FPQ--II-DE----PFSPS-PALKGKG------------------P-IRDLDNAS
gm004126_Glyma0 TQ---FLHS-RI-DTSPSIPF------FRSKS---------T------------RMDNLP
Os022387_Os05t0 -------------SD-----------------------------------P---------
pt037730_POPTR_ SE---FNN--PS-NE----QSSPL-SASKLKQ------------------P-PIDFSSNS
pp000633_Pp1s10 TE---FTAS-TL-ED-THVAYSGILSSPRSRA---------AVVDSS-------TLD-CD
Os029491_Os07t0 TE---FPLS-YH-ESFTSIPF------FKSKS---------V------------RANNS-
gm034540_Glyma1 -------------DS-----------------------------------T---PVNGHK
Sb028483_Sorbi1 PDSI-VAH--SV-GE----MFSSI---PLSKS---------STMDHSM------HFSSSR
gm030080_Glyma1 T----FPE--II-DE----PFSPS-PALKGKG------------------P-IRDLDNAS
pt000712_POPTR_ PE-L-LPC--SL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
Os040209_Os12t0 PDSV-LAR--SL-DE----SFGSI---SFSKS---------SIMDRSI------RFSSSR
Os009471_Os02t0 TG---IIH--SL-DE----QVPAL-STSKGKE------------------P-AIEFSSTS
Sm008088_Selmo1 TE---LAAA-PV-AD-DAVGEPGLSSSGGDRY---------V------------------
gm036751_Glyma1 TE---FSLN-NI-DMFPSFPF------FRSKS---------N------------RAENSM
Sb027814_Sorbi1 TG---TIQ--SL-DE----PVSTS-PSTKGKE------------------V-ALEFSSTS
gm019438_Glyma0 TD---FSVS-NI-D--TSFPF------FQTNS---------T------------SLENSI
gm003397_Glyma0 PE-L-LPR--SL-ED----SFRSI---SFARS-----------IDNST------EFSSSR
gm021743_Glyma0 PE-L-LPR--PL-ED----SFRSI---SFSKS-----------LDRSI------EFSSSR
pp034734_Pp1s15 TE---LAAG-SL-EE-VHVPYSSIMSSPRSKA---------AVVDSS-------ALESSE
Sb032884_Sorbi1 -------------SD-----------------------------------P---------
gm028527_Glyma1 PE-L-LPR--AL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
gm054928_Glyma2 PE-L-LPR--AL-ED----SFRSI---SFSKS-----------IDNST------EFSSSR
                                                                            

AT1G25280.1     FSE-MGISC--------------------------------DDNEEEASFRPLILKNKQP
pp034735_Pp1s15 FVS--------------------------GLL---------------NKEEPLVLRNKAP
gm041730_Glyma1 SGP--------------------------LVD---------------QKDGMLVLKNKAP
Sm016835_Selmo1 VAS---------------------------------------------KGKPLVLKNKPP
gm044675_Glyma1 LSE------------------------------------PPV--SSQCSAEQLALKNRAP
Sb024300_Sorbi1 LAT--------------------------------------------QNEAKMVLKNKSP
pp022942_Pp1s22 LVS--------------------------GVL---------------CKEEPLVLKNKAP
pt000709_POPTR_ FSN-IVGP---------------------------------REEDEEGKERPLVLRNKSP
pt041132_POPTR_ SGS--------------------------LSS---------------QREGALVLKNKAP
Os021774_Os05t0 FSD-IAGG-T-----------------------------INGDEEGQNKERPLVLRNKAP
Os022386_Os05t0 -LK-----------------------------------------KLISTSSPLALRNKAP
pt001717_POPTR_ RAE------------------------------------SSD--SICSKMDPLVLKNKAP
pt039357_POPTR_ FSD-IVGP---------------------------------REEDEEGKERPLVLRNKAP
Os009468_Os02t0 LSA-----------------------------------DLSG--PVCTNEVPLVLKNKAP
Os021773_Os05t0 FSD-IAGG-T-----------------------------INGDEEGQNKERPLVLRNKAP
gm021742_Glyma0 FSE-IGES---------------------------------IIEDDDGKMRPLVLKNKPP
gm030081_Glyma1 LPE-----------------------------------LLPV--ESQGSAEPLVLKNKAP
pt037558_POPTR_ PSQ------------------------------------SPV--LTQGSEEPLVLKNKAP
Sb030332_Sorbi1 FSE-ISGLAQQ------------------------------DEGSGQAKERPLALRNKEP
Os029490_Os07t0 TAS--------------------------LLT---------------QNGSKLVLKNKSP
Sb031457_Sorbi1 FSE-ISMSSHTIGD-----------------------AAL--GDNDECKDRPLILRNKAP
gm003396_Glyma0 FSD-IFVA---------------------------------GNEEEQGKGRPLVLKNKSP
pp034759_Pp1s15 FVS--------------------------GLL---------------NKEEPLVLRNKAP
pt002868_POPTR_ FSD-IVGP---------------------------------R-EDEEGKERPLVLRNKAP
Sb014893_Sorbi1 FSELIGGA-------------------------------LEESSDDFEKERPLVLRNKAP
gm045746_Glyma1 SGD--------------------------QSN---------------KKDDVLVLRNKAA
gm044959_Glyma1 FSD-IFLA---------------------------------GKEEEQGKDRPLVLKNKSP
gm039266_Glyma1 TDN------------------------------------TPE--SIQRAREPLILKNKAP
gm028526_Glyma1 FSD-IMGT---------------------------------GIEDEEGKVRPLVLKNKSP
pt025486_POPTR_ MNG-----------------------------------------LESASSGCTVLRNKAP
pp005711_Pp1s21 FAS--------------------------GLL---------------AKDEPLVLKNKAP
gm044960_Glyma1 FSD-IFLA---------------------------------GKEEEQGKDRPLVLKNKSP
pt037559_POPTR_ PSQ------------------------------------SPV--LTQGSEEPLVLKNKAP
gm048089_Glyma1 TAN------------------------------------TPE--SIQRAREPLVLKNKAP
gm036752_Glyma1 SGP--------------------------LVD---------------QKDGMLVLKNKAP
Sb032660_Sorbi1 FSD-IAGGAA-----------------------------IAGDEEGQNKERPLVLRNKAP
pt028965_POPTR_ MTQ-----------------------------------------LESASSGFTVLRNKAP
pp022947_Pp1s22 LVS--------------------------GVL---------------CKEEPLVLKNKAP
Sm012016_Selmo1 PYS--------------------------GVM---------------SKDGPLVLKNKAP
gm045744_Glyma1 SGD--------------------------QSN---------------KKDDVLVLRNKAA
gm021740_Glyma0 FSE-IGES---------------------------------IIEDDDGKMRPLVLKNKPP
pt000711_POPTR_ FSN-IVGP---------------------------------REEDEEGKERPLVLRNKSP
pt000710_POPTR_ FSN-IVGP---------------------------------REEDEEGKERPLVLRNKSP
gm045745_Glyma1 SGD--------------------------QSN---------------KKDDVLVLRNKAA
gm021741_Glyma0 FSE-IGES---------------------------------IIEDDDGKMRPLVLKNKPP
gm041219_Glyma1 FSE-IGES---------------------------------CIEDDDGKMRPLVLKNKPP
gm003133_Glyma0 LSE------------------------------------PPV--LSQGSTEQLALKNKAP
Os037720_Os11t0 FSD-ISIGDGPRIG---------------GRV---------LSDDEECKETPLILQNKAP
Os019651_Os04t0 FSE-FGGGALQGQ-------------------------EQEQDGDDVNKERPLVLRNKAP
gm037352_Glyma1 IPD-----------------------------------------KEQVASGYTILKNKAP
gm039265_Glyma1 TDN------------------------------------TPE--SIQRAREPLILKNKAP
gm003395_Glyma0 FSD-IFVA---------------------------------GNEEEQGKGRPLVLKNKSP
Sb026173_Sorbi1 FSD-IGGSSARFTGIPGSSARFTGIPGSSARFSGIAEGRLDNDEESETKERPLVLRNKPP
pt034249_POPTR_ SGP--------------------------LSS---------------QREGALVLRNKAP
gm054929_Glyma2 FSD-IMGI---------------------------------GNEDEEGKVRPLVLKNKSP
Os029803_Os08t0 FSE-ISGSANQ----------------------------QGEDDIPEAKERPLVLRNKVP
Os019649_Os04t0 FSE-FGGGALQGQ-------------------------EQEQDGDDVNKERPLVLRNKAP
pt001281_POPTR_ PSR------------------------------------SPV--LAQGSEELLVLKNKAP
Os004869_Os01t0 FSD-ISGSI------------------------------MGGDDNGEIKERPLVLRNKPP
gm001764_Glyma0 LPE-----------------------------------LLPV--QSQDSAEPLVLKNKAP
gm004126_Glyma0 TVP--------------------------LTC---------------QNEGTLVLRNKSP
Os022387_Os05t0 -LK-----------------------------------------KLISTSSPLALRNKAP
pt037730_POPTR_ LAE------------------------------------SSD--SLCSKNDPLILKNKAP
pp000633_Pp1s10 FVS--------------------------GPL---------------TKDAPLILKNKAP
Os029491_Os07t0 TAS--------------------------LLT---------------QNGSKLVLKNKSP
gm034540_Glyma1 MHD-----------------------------------------KEQAASGYTILKNKAP
Sb028483_Sorbi1 FSDAITADAIVSGG-----------------------QALSNADDEESTDTPLVLRNKAP
gm030080_Glyma1 LPE-----------------------------------LLPV--ESQGSAEPLVLKNKAP
pt000712_POPTR_ FSN-IVGP---------------------------------REEDEEGKERPLVLRNKSP
Os040209_Os12t0 YSD-ISVGGPMVGG-----------------------QAL--GDSDESKERPLILRNKAP
Os009471_Os02t0 LSA-----------------------------------DLSG--PVCTNEVPLVLKNKAP
Sm008088_Selmo1 ------------------------------------------------KGDPLVLKNKSP
gm036751_Glyma1 SGP--------------------------LVD---------------QKDGMLVLKNKAP
Sb027814_Sorbi1 LSA-----------------------------------DLSGLALACANETPLVLKNKAP
gm019438_Glyma0 SGD--------------------------QRN---------------KKDDVLVLRNKAA
gm003397_Glyma0 FSD-IFVA---------------------------------GNEEEQGKGRPLVLKNKSP
gm021743_Glyma0 FSE-IGES---------------------------------IIEDDDGKMRPLVLKNKPP
pp034734_Pp1s15 FVS--------------------------GLL---------------NKEEPLVLRNKAP
Sb032884_Sorbi1 -SK-----------------------------------------EKTPSSSSLDLKNKAP
gm028527_Glyma1 FSD-IMGT---------------------------------GIEDEEGKVRPLVLKNKSP
gm054928_Glyma2 FSD-IMGI---------------------------------GNEDEEGKVRPLVLKNKSP
                                                                      *:*: .

AT1G25280.1     RWHEQLQCWCLNFRGRVTVASVKNFQLVAARQP---------QPQG--------TGAAA-
pp034735_Pp1s15 RWHEQLQCWCLNFRGRVTVASVKNFQLVAA------TSVKAVSAAATT------------
gm041730_Glyma1 RWHEQLQCWCLNFHGRVTIASVKNFQLVASAENR--------------------------
Sm016835_Selmo1 RWHDQLQCWCLNFRGRVTVASVKNFQLVAATEIG------------------------Q-
gm044675_Glyma1 RWHEQLQCWCLNFKGRVSVASVKNFQLVAAVD----------------------------
Sb024300_Sorbi1 NWHEPLQCWCLNFHGRVTVASVKNFQLVASGESDLN------------------------
pp022942_Pp1s22 RWHEQLQCWCLNFRGRVTVASVKNFQLVAATTSSTTTSTTAGEAAAATGGGGGAGAATP-
pt000709_POPTR_ RWHEQLQCWCLNFRGRVSVASVKNFQLVAAT-----------QPAA----------GAP-
pt041132_POPTR_ RWHEQLQCWCLNFHGRVTVASVKNFQLVVSPENG--------------------------
Os021774_Os05t0 RWHEQLQCWCLNFRGRVTIASVKNFQLIAAPA----------QPPA----------GAP-
Os022386_Os05t0 RWHEHLQCWCLNFHGRVTVASVKNFQLVAPAGTS--------------------------
pt001717_POPTR_ RWHEQLQCWCLNFKGRVTVASVKNFQLVAAVE----------------------------
pt039357_POPTR_ RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPAA----------GAP-
Os009468_Os02t0 RWHEQLQCWCLNFRGRVTVASVKNFQLVASVD----------------------------
Os021773_Os05t0 RWHEQLQCWCLNFRGRVTIASVKNFQLIAAPA----------QPPA----------GAP-
gm021742_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA----------GAP-
gm030081_Glyma1 RWHEQLQCWCLNFKGRVTVASVKNFQLVSAVD----------------------------
pt037558_POPTR_ RWHEQLQCWCLNFRGRVTVASVKNFQLVAAVE----------------------------
Sb030332_Sorbi1 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAPQ----------LDS---------------
Os029490_Os07t0 RWHEHLQCWCLNFHGRVTVASVKNFQLVASDESN--------------------------
Sb031457_Sorbi1 RWHEQLQCWCLNFKGRVTVASVKNFQLVAA--T---------QPSA----------GAP-
gm003396_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA---------AGAP-
pp034759_Pp1s15 RWHEQLQCWCLNFRGRVTVASVKNFQLVAA------TSVKAVSAAATT------------
pt002868_POPTR_ RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPAA----------GAP-
Sb014893_Sorbi1 RWHEQLQCWSLNFRGGVTVASVKNFQLIFSVP----------HPAP-VG-----VFFAPP
gm045746_Glyma1 RWHEQLQCWCLNFHGRVTIASVKNFQLAVSPENG--------------------------
gm044959_Glyma1 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA---------TGAP-
gm039266_Glyma1 RWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE----------------------------
gm028526_Glyma1 RWHEQLQCWCLNFRGRVTVASVKNFQLIAST-----------PPAAVAP-----TGTGP-
pt025486_POPTR_ RWHEHLQCWCLNFHGRVTVASVKNFQLVATMDQS--------------------------
pp005711_Pp1s21 RWHEQLQCWCLNFRGRVTVASVKNFQLVASMES---------------------------
gm044960_Glyma1 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA---------TGAP-
pt037559_POPTR_ RWHEQLQCWCLNFRGRVTVASVKNFQLVAAVE----------------------------
gm048089_Glyma1 RWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE----------------------------
gm036752_Glyma1 RWHEQLQCWCLNFHGRVTIASVKNFQLVASAENG--------------------------
Sb032660_Sorbi1 RWHEQLQCWCLNFRGRVTIASVKNFQLIAAPSPA-------PAPAA----------RAP-
pt028965_POPTR_ RWHEHLQCWCLNFHGRVTVASVKNFQLVAIMDQS--------------------------
pp022947_Pp1s22 RWHEQLQCWCLNFRGRVTVASVKNFQLVAATTSSTTTSTTAGEAAAATGGGGGAGAATP-
Sm012016_Selmo1 RWHDQLQCWCLNFRGRVTVASVKNFQLVAALE----------------------------
gm045744_Glyma1 RWHEQLQCWCLNFHGRVTIASVKNFQLAVSPENG--------------------------
gm021740_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA----------GAP-
pt000711_POPTR_ RWHEQLQCWCLNFRGRVSVASVKNFQLVAAT-----------QPAA----------GAP-
pt000710_POPTR_ RWHEQLQCWCLNFRGRVSVASVKNFQLVAAT-----------QPAA----------GAP-
gm045745_Glyma1 RWHEQLQCWCLNFHGRVTIASVKNFQLAVSPENG--------------------------
gm021741_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA----------GAP-
gm041219_Glyma1 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPAA----------GAP-
gm003133_Glyma0 RWHEQLQCWCLNFKGRVSVASVKNFQLVAAVD----------------------------
Os037720_Os11t0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPAA----------GAP-
Os019651_Os04t0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAAP----------QPSS--G-----AASEP-
gm037352_Glyma1 RWHEHLQCWCLNFHGRVTVASVKNFQLVATVDQS--------------------------
gm039265_Glyma1 RWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE----------------------------
gm003395_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA---------AGAP-
Sb026173_Sorbi1 RWHEQLQCWCLNFRGRVTIASVKNFQLIAATT----------PPPA----------GAP-
pt034249_POPTR_ RWHEQLQCWCLNFHGRVTVASVKNFQLVASQENG--------------------------
gm054929_Glyma2 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------PPPAIVT-----TGTGP-
Os029803_Os08t0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAAS----------SESS------------Q-
Os019649_Os04t0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAAP----------QPSS--G-----AASEP-
pt001281_POPTR_ RWHEQLQCSCLNFRGRVTVASVKNFQLVASAE----------------------------
Os004869_Os01t0 RWHEQLQCWCLNFRGRVTIASVKNFQLVAAPS----------PPPA----------GAP-
gm001764_Glyma0 RWHEQLQCWCLNFNGRVTVASVKNFQLVAAVD----------------------------
gm004126_Glyma0 RWHEHLQCWCLNFNGRVTVASVKNFQLVASPKNG--------------------------
Os022387_Os05t0 RWHEHLQCWCLNFHGRVTVASVKNFQLVAPAGTS--------------------------
pt037730_POPTR_ RWHEQLQCWCLNFKGRVTVASVKNFQLVAAVE----------------------------
pp000633_Pp1s10 RWHEQLQCWCLNFRGRVTVASVKNFQLVAATDL---------------------------
Os029491_Os07t0 RWHEHLQCWCLNFHGRVTVASVKNFQLVASDESN--------------------------
gm034540_Glyma1 RWHEHLQCWCLNFHGRVTVASVKNFQLVATVDQS--------------------------
Sb028483_Sorbi1 RWHEQLQCWCLNFRGRVTVASVKNFQLVAAVMT---------QPAV----------GAP-
gm030080_Glyma1 RWHEQLQCWCLNFKGRVTVASVKNFQLVSAVD----------------------------
pt000712_POPTR_ RWHEQLQCWCLNFRGRVSVASVKNFQLVAAT-----------QPAA----------GAP-
Os040209_Os12t0 RWHEQLQCWCLNFKGRVTVASVKNFQLVAA--T---------QPAA----------GAP-
Os009471_Os02t0 RWHEQLQCWCLNFRGRVTVASVKNFQLVASVD----------------------------
Sm008088_Selmo1 RWHDQLQCWCLNFRGRVTVASVKNFQLVAAADQ-------------------------P-
gm036751_Glyma1 RWHEQLQCWCLNFHGRVTIASVKNFQLVASAENG--------------------------
Sb027814_Sorbi1 RWHEQLQCWCLNFRGRVTVASVKNFQLVASVD----------------------------
gm019438_Glyma0 RWHEQLECWCLNFHGRVTIASVKNFQLAVSPENG--------------------------
gm003397_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA---------AGAP-
gm021743_Glyma0 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------QPPA----------GAP-
pp034734_Pp1s15 RWHEQLQCWCLNFRGRVTVASVKNFQLVAA------TSVKAVSAAATT------------
Sb032884_Sorbi1 RWHDHLQCWCLNFHGRVTVASVKNFQLVATAGSG--------------------------
gm028527_Glyma1 RWHEQLQCWCLNFRGRVTVASVKNFQLIAST-----------PPAAVAP-----TGTGP-
gm054928_Glyma2 RWHEQLQCWCLNFRGRVTVASVKNFQLIAAT-----------PPPAIVT-----TGTGP-
                .**: *:* .***.* *::********                                 

AT1G25280.1     ---A-PTSAPAH----------------PEQDKVILQFGKVGKDMFTMDYRYPLSAFQAF
pp034735_Pp1s15 --------SSSS----------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
gm041730_Glyma1 ---------PAG----------------PEHDKIILQFGKVGKDLFTMDYRFPISAFQAF
Sm016835_Selmo1 -----P-PQPS------------------DPDNVILQFGKIGKDTFTMDYRYPLSAFQAF
gm044675_Glyma1 -----P-SHNISA---------------EEQEKVILQFGKIGKDIFTMDYCYPLSTFQAF
Sb024300_Sorbi1 ---N------------------------QGDDDVILQFGKVGKDLFTMDYRYPISAFQAF
pp022942_Pp1s22 -----A-PTSSG----------------SDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
pt000709_POPTR_ ---T-P-SQPAQ----------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAF
pt041132_POPTR_ ---------PAG----------------PEHENIILQFGKVGKDLFTMDYRYPISAFQAF
Os021774_Os05t0 ---T-P-SQPAP----------------PEQDKIILQFGKVAKDMFTMDYRYPLSAFQAF
Os022386_Os05t0 ---D-P------------WGI-------ADEETVILQFGKIEDDAFTMDYRQPLSAFQAF
pt001717_POPTR_ -----P-CQNVPV---------------EEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
pt039357_POPTR_ ---T-P-SQPAQ----------------SDHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
Os009468_Os02t0 -----P-SLGIPA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
Os021773_Os05t0 ---T-P-SQPAP----------------PEQDKIILQFGKVAKDMFTMDYRYPLSAFQAF
gm021742_Glyma0 ---T-P-SQPAP----------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
gm030081_Glyma1 -----P-SHNVSA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
pt037558_POPTR_ -----S-FHNVSS---------------ADQERVILQFGKIGKDIFTMDYRYPLSAFQAF
Sb030332_Sorbi1 -----ESSQQAQQQAQP-----SNSSSVLDHDKVILQFGKVAKDMFTMDYRYPLSAFQAF
Os029490_Os07t0 ---------PTN----------------QEHDDVILQFGKVGKDMFTMDYRYPISAFQAF
Sb031457_Sorbi1 ---TLS-SQATP-------------VPPPEHEKVILQFGKVAKDMFTMDYRYPLSAFQAF
gm003396_Glyma0 ---T-PSSQPAQ----------------SDHDKIILQFGK--QTIYVL---LPCSVMGFF
pp034759_Pp1s15 --------SSSS----------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
pt002868_POPTR_ ---T-P-SQPVQ----------------SDHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
Sb014893_Sorbi1 RGVT-PPTQTQPQ------------------------------------------ASGPF
gm045746_Glyma1 ---------HAG----------------LQEDEVILQFGKIGKDLFTMDYRYPISAFQAF
gm044959_Glyma1 ---T-PSSQPAQ----------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAF
gm039266_Glyma1 -----P-CQNVSA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
gm028526_Glyma1 ---T-P-SQPTQS--------------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAF
pt025486_POPTR_ ---Q-P------------GGR-------GDEDTVLLQFGKVGEDTFTMDYRLPLSAFQAF
pp005711_Pp1s21 -----L-PTSSQ----------------SDRDKVLLQFGKIGKDIFTMDYRYPLSAFQAF
gm044960_Glyma1 ---T-PSSQPAQ----------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAF
pt037559_POPTR_ -----S-FHNVSS---------------ADQERVILQFGKIGKDIFTMDYRYPLSAFQAF
gm048089_Glyma1 -----P-CQNVSA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
gm036752_Glyma1 ---------PAG----------------PEHDKIILQFGKVGKDLFTMDYRYPISAFQAF
Sb032660_Sorbi1 ---T-PSSQPVP----------------QDQDKIILQFGKVAKDMFTMDYRYPLSAFQAF
pt028965_POPTR_ ---Q-P------------GGK-------GDEETVLLQFGKVGDDTFTMDYRQPLSAFQAF
pp022947_Pp1s22 -----A-PTSSG----------------SDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
Sm012016_Selmo1 -----P-GQQAH----------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
gm045744_Glyma1 ---------HAG----------------LQEDEVILQFGKIGKDLFTMDYRYPISAFQAF
gm021740_Glyma0 ---T-P-SQPAP----------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
pt000711_POPTR_ ---T-P-SQPAQ----------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAF
pt000710_POPTR_ ---T-P-SQPAQ----------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAF
gm045745_Glyma1 ---------HAG----------------LQEDEVILQFGKIGKDLFTMDYRYPISAFQAF
gm021741_Glyma0 ---T-P-SQPAP----------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
gm041219_Glyma1 ---T-P-SQPAP----------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
gm003133_Glyma0 -----P-SHNISA---------------EEQEKVILQFGKIGKDIFTMDYCYPLSTFQAF
Os037720_Os11t0 ---T-P-SQPVP-------------PPPPEHDKVILQFGKVAKDMFTMDYHYPLSAFQAF
Os019651_Os04t0 ---S-QAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAKDMFTMDYRYPLSAFQAF
gm037352_Glyma1 ---Q-P------------GGK-------GDEETVLLQFGKVGDDTFTMDYRQPLSAFQAF
gm039265_Glyma1 -----P-CQNVSA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
gm003395_Glyma0 ---T-PSSQPAQ----------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAF
Sb026173_Sorbi1 ---T-P-SQPAP----------------SDPDKVILQFGKVARDMFTMDYRYPLSAFQAF
pt034249_POPTR_ ---------PAG----------------PEHENIILQFGKVGKDLFTMDYRYPISAFQAF
gm054929_Glyma2 ---T-P-SQPTQS--------------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAF
Os029803_Os08t0 ---L-EQQQQQQQQNHA-----SSSSSASDHGKVILQFGKVGKDMFTMDYRYPLSAFQAF
Os019649_Os04t0 ---S-QAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAKDMFTMDYRYPLSAFQAF
pt001281_POPTR_ -----P-SHNVPA---------------ADQERVILQFGKIGKDIFTMDYFYPLSAFQAF
Os004869_Os01t0 ---T-P-SQPGP----------------ADPEKVILQFGKVARDMFTMDYRYPLSAFQAF
gm001764_Glyma0 -----P-SHNVSA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
gm004126_Glyma0 ---------VSE----------------QAQENVILQFGKVGKDVFTMDYQYPISAFQAF
Os022387_Os05t0 ---D-P------------WGI-------ADEETVILQFGKIEDDAFTMDYRQPLSAFQAF
pt037730_POPTR_ -----P-CQNVPV---------------EEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
pp000633_Pp1s10 -----P-PTNSQ----------------NDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
Os029491_Os07t0 ---------PTN----------------QEHDDVILQFGKVGKDMFTMDYRYPISAFQAF
gm034540_Glyma1 ---Q-P------------GGK-------GDEETVLLQFGKVGDDTFTMDYRQPLSAFQAF
Sb028483_Sorbi1 ---T-P-SQAAPL---P-LPAPAPGPPLPDQEKVLLQFGKVGKDIFTMDYCYPLSAFQAF
gm030080_Glyma1 -----P-SHNVSA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
pt000712_POPTR_ ---T-P-SQPAQ----------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAF
Os040209_Os12t0 ---T-P-SQPAP-------------PPPPDHDKVILQFGKVAKDMFTMDYRYPLSAFQAF
Os009471_Os02t0 -----P-SLGIPA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
Sm008088_Selmo1 -----P-APVCQ----------------GEQDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
gm036751_Glyma1 ---------PAG----------------PEHDKIILQFGKVGKDLFTMDYRYPISAFQAF
Sb027814_Sorbi1 -----P-SLNIPA---------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAF
gm019438_Glyma0 ---------HAG----------------PQEDEVILQFGKVGKDLFTMDYRYPISAFQAF
gm003397_Glyma0 ---T-PSSQPAQ----------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAF
gm021743_Glyma0 ---T-P-SQPAP----------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAF
pp034734_Pp1s15 --------SSSS----------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAF
Sb032884_Sorbi1 ---G-P------------WGV-------GDEETVILQFGKIEDDAFTMDYRQPLSAFQAF
gm028527_Glyma1 ---T-P-SQPTQS--------------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAF
gm054928_Glyma2 ---T-P-SQPTQS--------------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAF
                                                                       .   *

AT1G25280.1     AICLSSFDTK--LACE-----
pp034735_Pp1s15 AICLSSFDTK--LACE-----
gm041730_Glyma1 AICLSSFDTK--IACE-----
Sm016835_Selmo1 AISLSSFDTKDSLHCTYALMF
gm044675_Glyma1 AICLSSFDTK--PACE-----
Sb024300_Sorbi1 AICLSSFDTK--ITRE-----
pp022942_Pp1s22 AICLSSFDTK--LACE-----
pt000709_POPTR_ AICLSSFDTK--LACE-----
pt041132_POPTR_ ALCLSSFDTK--IACE-----
Os021774_Os05t0 AICLSSFDTK--LACE-----
Os022386_Os05t0 AICLTSFGTK--LACE-----
pt001717_POPTR_ AICLSSFDTK--PACE-----
pt039357_POPTR_ AICLSSFDTK--LACE-----
Os009468_Os02t0 AICLTSFDTK--PACE-----
Os021773_Os05t0 AICLSSFDTK--LACE-----
gm021742_Glyma0 AICLSSFDTK--LACE-----
gm030081_Glyma1 AICLSSFDTK--PACE-----
pt037558_POPTR_ AICLSSFDTK--PACE-----
Sb030332_Sorbi1 TICLTSFDSK--LACE-----
Os029490_Os07t0 AICLSSFDTK--IACE-----
Sb031457_Sorbi1 AICLSSFDTK--LACE-----
gm003396_Glyma0 LW-------------------
pp034759_Pp1s15 AICLSSFDTK--LACE-----
pt002868_POPTR_ AICLSSFDTK--LACE-----
Sb014893_Sorbi1 ---------------------
gm045746_Glyma1 AICLSSFATT--VACE-----
gm044959_Glyma1 AICLTSFDTK--LACE-----
gm039266_Glyma1 AICLSSFDTK--PACE-----
gm028526_Glyma1 AICLTSFDTK--LACE-----
pt025486_POPTR_ AICLTSFGTK--LACE-----
pp005711_Pp1s21 AICLSSFDTK--LACE-----
gm044960_Glyma1 AICLTSFDTK--LACE-----
pt037559_POPTR_ AICLSSFDTK--PACE-----
gm048089_Glyma1 AICLSSFDTK--PACE-----
gm036752_Glyma1 AICLSSFDTK--IACE-----
Sb032660_Sorbi1 AICLSSFDTK--LACE-----
pt028965_POPTR_ ALCLTSFGTK--LACE-----
pp022947_Pp1s22 AICLSSFDTK--LACE-----
Sm012016_Selmo1 GICLSSFDTK--LACE-----
gm045744_Glyma1 AICLSSFATT--VACE-----
gm021740_Glyma0 AICLSSFDTK--LACE-----
pt000711_POPTR_ AICLSSFDTK--LACE-----
pt000710_POPTR_ AICLSSFDTK--LACE-----
gm045745_Glyma1 AICLSSFATT--VACE-----
gm021741_Glyma0 AICLSSFDTK--LACE-----
gm041219_Glyma1 AICLSSFDTK--LACE-----
gm003133_Glyma0 AICLSSFDTK--PACE-----
Os037720_Os11t0 AISLSSFDTK--LACE-----
Os019651_Os04t0 AICLTSFDTK--LACE-----
gm037352_Glyma1 AICLTSFGTK--LACE-----
gm039265_Glyma1 AICLSSFDTK--PACE-----
gm003395_Glyma0 AICLTSFDTK--LACE-----
Sb026173_Sorbi1 AICLSSFDTK--LACE-----
pt034249_POPTR_ AICLSSFDTK--IACE-----
gm054929_Glyma2 AICLTSFDTK--LACE-----
Os029803_Os08t0 AICLTSFDTK--LACE-----
Os019649_Os04t0 AICLTSFDTK--LACE-----
pt001281_POPTR_ AICLSSFDTK--PACE-----
Os004869_Os01t0 AICLSSFDTK--LACE-----
gm001764_Glyma0 AICLSSFDTK--PACE-----
gm004126_Glyma0 AICLSSFDTK--IACE-----
Os022387_Os05t0 AICLTSFGTK--LACE-----
pt037730_POPTR_ AICLSSFDTK--PACE-----
pp000633_Pp1s10 AICLSSFDTK--LACE-----
Os029491_Os07t0 AICLSSFDTK--IACE-----
gm034540_Glyma1 AICLTSFGTK--LACE-----
Sb028483_Sorbi1 AICLSSFDTK--LACE-----
gm030080_Glyma1 AICLSSFDTK--PACE-----
pt000712_POPTR_ AICLSSFDTK--LACE-----
Os040209_Os12t0 AICLSSFDTK--LACE-----
Os009471_Os02t0 AICLTSFDTK--PACE-----
Sm008088_Selmo1 AICLSSFDTK--LACE-----
gm036751_Glyma1 AICLSSFDTK--IACE-----
Sb027814_Sorbi1 AICLTSFDTK--PACE-----
gm019438_Glyma0 AICLSSFATT--VACE-----
gm003397_Glyma0 AICLTSFDTK--LACE-----
gm021743_Glyma0 AICLSSFDTK--LACE-----
pp034734_Pp1s15 AICLSSFDTK--LACE-----
Sb032884_Sorbi1 AICLTSFGTK--LACE-----
gm028527_Glyma1 AICLTSFDTK--LACE-----
gm054928_Glyma2 AICLTSFDTK--LACE-----
                                     


BoxShade v3.31 C (beta, 970507) Output
AT1G25280.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034735_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S - - - - - - - G S
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm016835_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S - - - - - - - - S
gm044675_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb024300_Sorbi1    - - A E E C - - - - - - - - - - - - - - - - - - - - - - - - S C G G G G - - - G F - - W R V G G R E R - - - - - - Q A S
pp022942_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000709_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt041132_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os021774_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022386_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001717_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt039357_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os009468_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os021773_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021742_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037558_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb030332_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029490_Os07t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb031457_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034759_Pp1s15    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt002868_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb014893_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044959_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039266_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028526_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt025486_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044960_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037559_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm048089_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb032660_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - L
pt028965_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm012016_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S S - - - - - S S S
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021740_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000711_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000710_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003133_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm037352_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039265_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003395_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb026173_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt034249_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054929_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029803_Os08t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019649_Os04t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001281_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os004869_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm004126_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022387_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037730_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp000633_Pp1s10    M L A S E C L T V H G L R R W L K L W L I L L K R S L E G I W C E V S R R E L G F C K W T M S G Q K S - - - - - - - - S
Os029491_Os07t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm034540_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb028483_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030080_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000712_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os040209_Os12t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os009471_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb027814_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021743_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034734_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S - - - - - - - G S
Sb032884_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - I F G A V S S P F F F P L S F
gm028527_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054928_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
 
AT1G25280.1     - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R G - - - I V - - - Q D L R D G F G S L S R R -
pp034735_Pp1s15    S M M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - L I R E F Q E M K G G R G G I S R R -
gm041730_Glyma1    - M C L I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - M - - - - - - - - - - - - - - - - - -
Sm016835_Selmo1    T L T P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - W S - - - V I - - - Q D I K - G I G S I S R R -
gm044675_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V R E L K E M R D G I G S T S K R -
Sb024300_Sorbi1    G D M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - S S - - - M I - - - H E M K G E I G A I S S R -
pp022942_Pp1s22    - - M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - L I R E F Q E M K G G I G N I S R R -
pt000709_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D M R D G F G S L S R R -
pt041132_POPTR_    - M S A I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I I - - - - - - - - - - - - - - - - -
Os021774_Os05t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
Os022386_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M A L W - R C S S S W L S S V S R S S
pt001717_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - - - - K L K E I R D D I T T T F S M G
pt039357_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D M R D G F G S L S R R -
Os009468_Os02t0    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L R E M R D G I G S M S R R -
Os021773_Os05t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
gm021742_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
gm030081_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L K E M R D G I G S M S R R -
pt037558_POPTR_    - - M S I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L K E M K D G I G N I S R R -
Sb030332_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029490_Os07t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - V I - - - Q E V K G E I G A I S R R -
Sb031457_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
pp034759_Pp1s15    - - M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - L I R E F Q E M K G G R G G I S R R -
pt002868_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D M R D G F G S L S R R -
Sb014893_Sorbi1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - M V - - - R D I R E S F G N I S R R -
gm045746_Glyma1    - M I E V - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Q A - - - N - - - - - - - - - - - - - - - - - -
gm044959_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
gm039266_Glyma1    - - M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V R E L K E I G E G I S N M Y R R -
gm028526_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R E V R D G F G S L S R R -
pt025486_POPTR_    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R R - - - S I L S - R R F S R S F N N Q N R N E
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M K S G V G R I S R R -
gm044960_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
pt037559_POPTR_    - - M S I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L K E M K D G I G N I S R R -
gm048089_Glyma1    - - M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V R E L K E I G E G I S N M Y R R -
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb032660_Sorbi1    A K M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
pt028965_POPTR_    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R R - - - S F L S - R R F S R S F N N Q N R N E
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M K G G I G N I S R R -
Sm012016_Selmo1    S L L P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I L R E F Q D I R D G I G S L S R R -
gm045744_Glyma1    - M I E V - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Q A - - - N - - - - - - - - - - - - - - - - - -
gm021740_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
pt000711_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D M R D G F G S L S R R -
pt000710_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D M R D G F G S L S R R -
gm045745_Glyma1    - M I E V - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Q A - - - N - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
gm041219_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
gm003133_Glyma0    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V R E L K E M R D G I G S T S K R -
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D F R D S F G T L S K R -
gm037352_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R K - - - V F R S - R K F S R S F K E V L P A E
gm039265_Glyma1    - - M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V R E L K E I G E G I S N M Y R R -
gm003395_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
Sb026173_Sorbi1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
pt034249_POPTR_    - M P A L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I I - - - - - - - - - - - - - - - - -
gm054929_Glyma2    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
Os029803_Os08t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
Os019649_Os04t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D F R D S F G T L S K R -
pt001281_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I M R E F K E I K E G I G S I S R R -
Os004869_Os01t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
gm001764_Glyma0    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L K E M R D G I G S M S R R -
gm004126_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I I - - - L E - - - - - - - - - R K -
Os022387_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M A L W - R C S S S W L S S V S R S S
pt037730_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K G - - - - - - K L K E I R D D I S T T F S M G
pp000633_Pp1s10    S M M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - L I R E F Q E M K G G I G N I S R R -
Os029491_Os07t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - V I - - - Q E V K G E I G A I S R R -
gm034540_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R K - - - V F R S - R K F S K S F K E V L P A E
Sb028483_Sorbi1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
gm030080_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L K E M R D G I G S M S R R -
pt000712_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D M R D G F G S L S R R -
Os040209_Os12t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
Os009471_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M R D G I G S M S R R -
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S R - -
gm036751_Glyma1    - M G L I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - M - - - - - - - - - - - - - - - - - -
Sb027814_Sorbi1    A A M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - I V R E L K E M R D G I G S M S R R G
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
gm021743_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D S F G S L S R R -
pp034734_Pp1s15    S M M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - L I R E F Q E M K G G R G G I S R R -
Sb032884_Sorbi1    S F L S L A S L P C S L P P P A P F I P P S A R A N L F R G R A G I G A R R P P V M I S W - R R S A S W L S S A S R S S
gm028527_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R E V R D G F G S L S R R -
gm054928_Glyma2    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - I V - - - R D V R D G F G S L S R R -
 
AT1G25280.1     - - - - - S F D F R - - - - - - - L S S L - - - - - - H K G K A - Q G S S F R E Y S S - - - - - - - S R D L L S P V I V
pp034735_Pp1s15    - - - - - S F E L K - - - - - - - F P H H - - - - - - H K G R S - S G - - - M V L D - - - - - - - - E S Q L R V E A V V
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S Q S - Q R - - - V V Q E Q E E A E - - - C - - - - V G D S M
Sm016835_Selmo1    - - - - - S F E V K - - - - - - - L P T Y - - - - - - S R S R S - H S - - - A A Q D A A G R H Q F G E S G - - - - - - -
gm044675_Glyma1    - - - - - G A E S K H W L - - - - - - - - - - - - - - S R T K S - H V A P D I L A T P F E P I Q Q - G Q - - - - - - - -
Sb024300_Sorbi1    - - - - - G L - L R F R - - - - - S G G H A - - - - A A A G R A - S A A A - - - - - - - - - - - E - - - - - - P D E A L
pp022942_Pp1s22    - - - - - S F E L K - - - - - - - F P H H - - - - - - H K G R S - S G - - - M V L D - - - - - - - - E S Q L R A E P V V
pt000709_POPTR_    - - - - - S F E V R - - - - - - - L P G H - - - - - - F R G K S - H G S A C E L L D - - - - - - - - - - - - - Q P V V I
pt041132_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - N R S R S - H R - - - V V Q Y S S A P D - - - L S L F G G G C G A
Os021774_Os05t0    - - - - - S F E V T L A G L - S G L T G H - - - - - - H R G K S - Q S T V H E L C D - - - - - - - - - - - - - A D L I I
Os022386_Os05t0    - G G V G G G E S K V S P E I A P V S G G E G E G E E E E G E E - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001717_POPTR_    - - - - - K L Q R N R T N - - - - - - - - - - - - - - R R G R A - Y I A P E L - - - - - - - - G G - G S E L L S E L I E
pt039357_POPTR_    - - - - - S F E V R - - - - - - - L P G H - - - - - - L R G K S - H G S A C E L Q D - - - - - - - - - - - - - Q P V V I
Os009468_Os02t0    - - - - - A A D G R A G G - - - - - - - - - - - - - - G R G G S R H S W P V L W S E Q Q Q P P Q Q - Q Q L Q R Q E H Q Q
Os021773_Os05t0    - - - - - S F E V T L A G L - S G L T G H - - - - - - H R G K S - Q S T V H E L C D - - - - - - - - - - - - - A D L I I
gm021742_Glyma0    - - - - - S F D V R - - - - - - - L T G H - - - - - - H R G K S - Q G S V Q D L H D - - - - - - - - - - - - - Q P L V I
gm030081_Glyma1    - - - - - G V E S R R W N - - - - - - - - - - - - - - G R T K S - H V A P D V T L T S L E P I Q Q - G H - - - - - - - -
pt037558_POPTR_    - - - - - G L E G K H W R - - - - - - - - - - - - - - G R A R S - H I A P D E T P A E T D Q I E Q - G Q - - - - - - - -
Sb030332_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029490_Os07t0    - - - - - G F - - - - - - - - - - - - - - - - - - - - - R S R P - G R V R R V A A A A E E P P - - - D E S S A A A L V M
Sb031457_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    - - - - - S F D V R - - - - - - - I S G G - - - - - - - - G K L - N S L V H E A H E - - - - - - - - - - - - - R Q L V I
pp034759_Pp1s15    - - - - - S F E L K - - - - - - - F P H H - - - - - - H K G R S - S G - - - M V L D - - - - - - - - E S Q L R V E A V V
pt002868_POPTR_    - - - - - S F E V R - - - - - - - L P G H - - - - - - H R G K S - H S S A C E L H D - - - - - - - - - - - - - Q P V V I
Sb014893_Sorbi1    - - - - - N F E V R I - - - - - - - - - H - - - - - - H R G K S - L G S S S D L Q D - - - - - - - - - - - - - K P A E I
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A M
gm044959_Glyma1    - - - - - S F D V R - - - - - - - L S G G - - - - - - - - G K S - N S L V H E E H E - - - - - - - - - - - - - C L P V V
gm039266_Glyma1    - - - - - G G E A K H V H - - - - - - - - - - - - - - R H G K S - H I A P E C S L P P P P P P P P - S S S S - - - - - -
gm028526_Glyma1    - - - - - S F E V R - - - - - - - L P G H - - - - - - N R G K S - R S L V H E L Q D - - - - - - - - - - - - - Q P P V I
pt025486_POPTR_    R N A V - - - E S G R L G G - - - - - - - - - - - - E L W A E S - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp005711_Pp1s21    - - - - - S F E L K - - - - - - - F P H H - - - - - - H R G R S - S G - - - M V L D - - - - - - - - E S Q L N S E P V V
gm044960_Glyma1    - - - - - S F D V R - - - - - - - L S G G - - - - - - - - G K S - N S L V H E E H E - - - - - - - - - - - - - C L P V V
pt037559_POPTR_    - - - - - G L E G K H W R - - - - - - - - - - - - - - G R A R S - H I A P D E T P A E T D Q I E Q - G Q - - - - - - - -
gm048089_Glyma1    - - - - - G G E A K H V H - - - - - - - - - - - - - - R H G K S - H I A P E C S L P P P P S S S S - S S S S S S - - - S
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb032660_Sorbi1    - - - - - S F E V T I A G L - S G L T V H - - - - - - H R G K S - Q S T V H E V C D - - - - - - - - - - - - - T D L I I
pt028965_POPTR_    R N G V - - - E S G R L V G - - - - - - - - - - - - E S G G E S - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022947_Pp1s22    - - - - - S F E L K - - - - - - - F P H H - - - - - - H K G R S - S G - - - M V L D - - - - - - - - E S Q L R A E P V V
Sm012016_Selmo1    - - - - - S F E V R - - - - - - - L P Y H - - - - - - H R S R S - H S - - - V V L D - - - - - - - - E P P V R D V V V L
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A M
gm021740_Glyma0    - - - - - S F D V R - - - - - - - L T G H - - - - - - H R G K S - Q G S V Q D L H D - - - - - - - - - - - - - Q P L V I
pt000711_POPTR_    - - - - - S F E V R - - - - - - - L P G H - - - - - - F R G K S - H G S A C E L L D - - - - - - - - - - - - - Q P V V I
pt000710_POPTR_    - - - - - S F E V R - - - - - - - L P G H - - - - - - F R G K S - H G S A C E L L D - - - - - - - - - - - - - Q P V V I
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A M
gm021741_Glyma0    - - - - - S F D V R - - - - - - - L T G H - - - - - - H R G K S - Q G S V Q D L H D - - - - - - - - - - - - - Q P L V I
gm041219_Glyma1    - - - - - S F D V R - - - - - - - L T G H - - - - - - H R G K S - Q G S V Q D L H D - - - - - - - - - - - - - Q P L V I
gm003133_Glyma0    - - - - - G A E S K H R L - - - - - - - - - - - - - - S R T K S - H V A P D V L A T P F E P I Q Q - G Q - - - - - - - -
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    - - - - - S F E V K I S - - - - G F S G R - - - - - - H R G K S - I G P S S E L D D - - - - - - - - - - - - - T P V V A
gm037352_Glyma1    G A A I V G G E D G V A G A G E - - - - - - - - - E S S N G - N - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039265_Glyma1    - - - - - G G E A K H V H - - - - - - - - - - - - - - R H G K S - H I A P E C S L P P P P P P P P - S S S S - - - - - -
gm003395_Glyma0    - - - - - S F D V R - - - - - - - I S G G - - - - - - - - G K L - N S L V H E A H E - - - - - - - - - - - - - R Q L V I
Sb026173_Sorbi1    - - - - - S F E V T L A S I - Y G L T G H - - - - - - H K G K T - Q S S L H E L D D - - - - - - - - - - - - - S P S I I
pt034249_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - N R S T S - H R - - - V V Q Y S S A P E - - - L N L F A A G G A A
gm054929_Glyma2    - - - - - S F E V R - - - - - - - L P G H - - - - - - N R G K S - R S S V H E L Q D - - - - - - - - - - - - - Q P P V I
Os029803_Os08t0    - - - - - S F E V R I S G L - P G L S G H - - - - - - H R G K S - L G S L S E L R D - - - - - - - - - - - - - R P V V V
Os019649_Os04t0    - - - - - S F E V K I S - - - - G F S G R - - - - - - H R G K S - I G P S S E L D D - - - - - - - - - - - - - T P V V A
pt001281_POPTR_    - - - - - G V E G K H W C - - - - - - - - - - - - - - G R V R S - H I A P D E T R E E T D Q I D Q - G Q - - - - - - - -
Os004869_Os01t0    - - - - - S F E V T L A S L - Y G L T G H - - - - - - H K G K T - Q S S L D E L D D - - - - - - - - - - - - - S P A I I
gm001764_Glyma0    - - - - - G V E S R R W N - - - - - - - - - - - - - - G R T K S - H V A P D V I L T S L E P I Q Q - G Q - - - - - - - -
gm004126_Glyma0    - - - - - G F E V K - - - - - - - F G Y S M - - - - R S R S Q S - H S D - A I A Q D S - - - - - - - - - - L V V L D G L
Os022387_Os05t0    - G G V G G G E S K V S P E I A P V S G G E G E G E E E E G E E - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037730_POPTR_    - - - - - K L Q R N R T N - - - - - - - - - - - - - - R R G R A - Y I A P E L - - - - - - - - G G - G S E L F R E L I E
pp000633_Pp1s10    - - - - - S F E L K - - - - - - - F P H H - - - - - - H R G R S - S G - - - M V L D - - - - - - - - E S Q L R P E R V V
Os029491_Os07t0    - - - - - G F - - - - - - - - - - - - - - - - - - - - - R S R P - G R V R R V A A A A E E P P - - - D E S S A A A L V M
gm034540_Glyma1    G A A V - - - E G G V A G T V E - - - - - - - - - E A A N G N N - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb028483_Sorbi1    - - - - - G F E V R - - - - - - - F L S P - - - - - - R R G K S - H G A V H E L H D - - - - - - - - - - - - - P V P V V
gm030080_Glyma1    - - - - - G V E S R R W N - - - - - - - - - - - - - - G R T K S - H V A P D V T L T S L E P I Q Q - G H - - - - - - - -
pt000712_POPTR_    - - - - - S F E V R - - - - - - - L P G H - - - - - - F R G K S - H G S A C E L L D - - - - - - - - - - - - - Q P V V I
Os040209_Os12t0    - - - - - G F E V R - - - - - - - L V G H - - - - - - R R G R S - H S A V H E L R D G - - - - - - - H A A A A A A D V V
Os009471_Os02t0    - - - - - A A D G R A G G - - - - - - - - - - - - - - G R G G S R H S W P V L W S E Q Q Q P P Q Q - Q Q L Q R Q E H Q Q
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S R S - Q R - - - V V Q E Q E A A E - - - C V G V V V G D S M
Sb027814_Sorbi1    G - - - S G S D G R A G H - - - - - - - - - - - - - - G R S G S R H S W P S L W A E Q Q Q P Q R Q - G Q E G P Q H Q H Q
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M
gm003397_Glyma0    - - - - - S F D V R - - - - - - - I S G G - - - - - - - - G K L - N S L V H E A H E - - - - - - - - - - - - - R Q L V I
gm021743_Glyma0    - - - - - S F D V R - - - - - - - L T G H - - - - - - H R G K S - Q G S V Q D L H D - - - - - - - - - - - - - Q P L V I
pp034734_Pp1s15    - - - - - S F E L K - - - - - - - F P H H - - - - - - H K G R S - S G - - - M V L D - - - - - - - - E S Q L R V E A V V
Sb032884_Sorbi1    L G A A V G G E A K V T P E V D P A A A Q E M E - E D E E A D E - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028527_Glyma1    - - - - - S F E V R - - - - - - - L P G H - - - - - - N R G K S - R S L V H E L Q D - - - - - - - - - - - - - Q P P V I
gm054928_Glyma2    - - - - - S F E V R - - - - - - - L P G H - - - - - - N R G K S - R S S V H E L Q D - - - - - - - - - - - - - Q P P V I
 
AT1G25280.1     Q T - S R W A N L P P E L L F D V I K R L E E S E S N W P A R K H V V A C A S V C R S W - R A M C Q E I V L - G P E I C
pp034735_Pp1s15    K Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S
gm041730_Glyma1    R Q - S C W A N M P Q E L L R E V L F R I E A S E D A W P P R K S V V A C A G V C R S W - R Q I T I D I V K - T P E L S
Sm016835_Selmo1    Q Q - S R W A N M P P E L L R D V I Q R V E A S D K M W P S R K S V V A C A A V C R N W - R K I T K E I V Q - T L E Q C
gm044675_Glyma1    - - - - - W A N L P S E L L L D I I Q R I E E S E T S W P A R A V V V F C A S V C K S W - R S I T R E I V K - T P E Q C
Sb024300_Sorbi1    R E - S C W A R V P P E L L R M V L A R V E H E E A R W P G R S A V V A S A G V C R C W - R A V V K E M V R - V P E V S
pp022942_Pp1s22    E Q - S C W A N M P P E L L R D V I Q R V E A S E N A W P S R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S
pt000709_POPTR_    Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S
pt041132_POPTR_    E T T S C W A N L P Q E L L R E V L I R I E E S E S S W P P R K N V V A C A G V C R S W - R D I T K E L V K - V P E L S
Os021774_Os05t0    Q E - S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W - R E M C K E I V L - S P E F C
Os022386_Os05t0    - - - E R W S R L L P E L L T E I M R R V D A G A E R W P P R R D V V A C A C V C R R W - R D A A V S V V R - P P L E C
pt001717_POPTR_    E Q - S P W A N L P P E L L Q D V I K R V E G S E T S W P G R R D V V A C A S V C T S W - R E I T K A V V K - T P E Q C
pt039357_POPTR_    Q N - S R W A G L P P E L L Q D V I K R L E A S E S T W P S R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S
Os009468_Os02t0    Q Q - G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W - R E V T K E V V K - T L E E C
Os021773_Os05t0    Q E - S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W - R E M C K E I V L - S P E F C
gm021742_Glyma0    Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C
gm030081_Glyma1    - - - - - W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V T K E I V K - T P E Q C
pt037558_POPTR_    - - - - - W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W - R E I T K E I V K - T P E Q C
Sb030332_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029490_Os07t0    R E - S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W - R G I V R E I V R - T P E A S
Sb031457_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    Q N - S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M C K E I V T - S P E F C
pp034759_Pp1s15    K Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S
pt002868_POPTR_    Q N - S R W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A A V C S A W - R E M C K E I V R - N P E F S
Sb014893_Sorbi1    Q Q - S R W A S L P P E L L R D V M K R L E E D D S S W P D R K D V V C C A S V C T T W - R D M C K D I V R - S P E H C
gm045746_Glyma1    E Q - S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I V K E I V K - P P Q F S
gm044959_Glyma1    Q N - S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V V A C A A V C R S W - R G M C K E I V T - S P E F C
gm039266_Glyma1    - Q - S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C R L W - R E I T K D V I K - T P E Q C
gm028526_Glyma1    Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C
pt025486_POPTR_    - - - D G W G S M L P E L L G E I I K R V E E S E D R W P Q R Q S V V A C A C V C K K W - R D V T K D I V K S L P N S S
pp005711_Pp1s21    E Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P S R K H V V A C A A V C S S W - R E V T K E L V R - A P E Q S
gm044960_Glyma1    Q N - S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V V A C A A V C R S W - R G M C K E I V T - S P E F C
pt037559_POPTR_    - - - - - W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W - R E I T K E I V K - T P E Q C
gm048089_Glyma1    W Q - S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C K L W - R E I T K D V V K - T P E Q C
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb032660_Sorbi1    Q E - S R W A N L P P E L L R D V I R R L E A S E S T W P N R K H V V S C A A V C R A W - R E M C R E I V L - S P E F C
pt028965_POPTR_    - - - D G W G S M L P E L L G E I I K R V E E S E D R W P Q R Q N V V A C A C V C K K W - R E V T K D I V K S L P N N N
pp022947_Pp1s22    E Q - S C W A N M P P E L L R D V I Q R V E A S E N A W P S R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S
Sm012016_Selmo1    Q Q - S R W A S M P P E L L R D V I Q R L E S S E H T W P A R K N V V V C A E V C S Q W - R D I A K E L V K - T P E Q S
gm045744_Glyma1    E Q - S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I V K E I V K - P P Q F S
gm021740_Glyma0    Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C
pt000711_POPTR_    Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S
pt000710_POPTR_    Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S
gm045745_Glyma1    E Q - S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I V K E I V K - P P Q F S
gm021741_Glyma0    Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C
gm041219_Glyma1    Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C
gm003133_Glyma0    - - - - - W A N L P S E L L L D I I Q R V E E S E T S W P A R A V V V F C A S V C K S W - R S I T R E I V K - T P E Q C
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    Q Q - S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W - R D M C K D I V R - N P E F C
gm037352_Glyma1    - - - N G W S N M L P E I L G E I V R R V D A A E E Q W P N R Q N V V A C A C V C K R W - R D I T R E V V R - V P S H T
gm039265_Glyma1    - Q - S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C R L W - R E I T K D V I K - T P E Q C
gm003395_Glyma0    Q N - S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M C K E I V T - S P E F C
Sb026173_Sorbi1    R E - S R W A N L P P E L I R D I I R R L E A D E S T W P A R K H V V C F A A V C R T W - R E M C K E I V L - S P E L C
pt034249_POPTR_    E T A S C W A N L P Q E L L R E V L V R I E E S E S S W P P R K N V V A C A G V C R S W - R H I T K D L V K - V P E L S
gm054929_Glyma2    Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C
Os029803_Os08t0    D Q - S R W V G L P P E L L R D V M K R L E E G E S N W P S R K D V V A C A A V C R T W - R E I C K D I V Q - S P E I C
Os019649_Os04t0    Q Q - S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W - R D M C K D I V R - N P E F C
pt001281_POPTR_    - - - - - W A N L P P E L L L D I I M R L E E S E S S W P A R V V V V H C A S V C R S W - R E I T K E I V K - T P E Q C
Os004869_Os01t0    P E - S R W A S L P P E L L R E V I R R L E A D E S T W P S R R N V V C F A A V C R T W - R E M C K E T V L - S P E F C
gm001764_Glyma0    - - - - - W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V T K E I V K - T P E Q C
gm004126_Glyma0    K Q - S C W A N M P P E L L R D V L M R I E A S E D S W P A Q K H V V A C A G V C R S W - R E I M K E I V K - S P Q L S
Os022387_Os05t0    - - - E R W S R L L P E L L T E I M R R V D A G A E R W P P R R D V V A C A C V C R R W - R D A A V S V V R - P P L E C
pt037730_POPTR_    E Q - S P W A N L P P E L L H D V I Q R V E G S E T S W P G R R D V V A C A S V C K S W - R E I T K T V V K - T P E Q C
pp000633_Pp1s10    E Q - S C W A N M P P E L L R D V I Q R V E V S E S T W P S R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S
Os029491_Os07t0    R E - S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W - R G I V R E I V R - T P E A S
gm034540_Glyma1    - - - N G W S S M L P E I L G E I V R R V D A A E E Q W P N R Q N V V A C A C V C K R W - R D I T R E V V R - V P S H T
Sb028483_Sorbi1    Q S - S C W A S L P P E L L R D V I E R L E T S E D T W P S R K H V V A C A A V C R T W - R E M C R E I V K - S P E V S
gm030080_Glyma1    - - - - - W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V T K E I V K - T P E Q C
pt000712_POPTR_    Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S
Os040209_Os12t0    Q S - S C W A N L P P E L L R D V I E R L E A S E A A W P S R K N V V A C A A V C R T W - R D M C R E I V K - N P E F C
Os009471_Os02t0    Q Q - G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W - R E V T K E V V K - T L E E C
Sm008088_Selmo1    - Q - S C W A N M P P E L L R D I I Q R L E S S D N V W P S R K N V V A C A A V C S T W - R E I T K E L V K - S P E L S
gm036751_Glyma1    R Q - S C W A N M P Q E L L R E V L L R I E A S E D T W P P R K S V V S C A G V C R S W - R H I T K D I V K - T P E L S
Sb027814_Sorbi1    H Q - G R W A N L P P E L L L D V I Q R V E S S E A T W P A R R Q V V A C A A V C R S W - R E V T K E V V K - T L E E C
gm019438_Glyma0    E Q - S W R A N M P R E L L R E V L L R I E S S E A T W P S R R S V V A C G G V C R T W - R L I V K E I V K - P P Q L S
gm003397_Glyma0    Q N - S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M C K E I V T - S P E F C
gm021743_Glyma0    Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C
pp034734_Pp1s15    K Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S
Sb032884_Sorbi1    - - - E R W S R L L P E L L T E I M R R V D A G A E R W P P R R D V V V C A C V C R R W - R D A A V S V V R - P P L E C
gm028527_Glyma1    Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C
gm054928_Glyma2    Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C
 
AT1G25280.1     - - - - - - - - G K L T F P V S L K Q P G P R D A - - M I Q C F I K R D K S K L T F H L F L C L S P A L - - - L - V E N
pp034735_Pp1s15    - - - - - - - - G R L T F P I A L K Q P G P R E S - - T V Q C F I K R D R T S S T Y Q L Y L G L P P S - - - - L - V E N
gm041730_Glyma1    - - - - - - - - S K I T F P I S V K Q P G P R E N - - L L R C F I K R N R S S Q T Y Y L Y L S L T N T - - - - L - A E D
Sm016835_Selmo1    - - - - - - - - G R L T F P V S L K Q P G P R D A - - T V Q C Y L K R D R T T S T Y Y L Y L G I T P S - - K P S - K K N
gm044675_Glyma1    - - - - - - - - G R I T F P I S L K Q P G P R D S - - P I Q C F I R R N K E T S T Y L L Y F G L V P S - - - - - E N D G
Sb024300_Sorbi1    - - - - - - - - G K I T F P I S L K Q P G P R D A - - P M K C F I R R N R A T Q S Y S L C I G I T D A - - - - L - A D D
pp022942_Pp1s22    - - - - - - - - G R L T F P I A L K Q P G P R D S - - T M Q C F I K R D R T T S T Y Q L F L G L P P S - - - - L - V E N
pt000709_POPTR_    - - - - - - - - G K I T F P V S L K Q P G P R D G - - T V Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
pt041132_POPTR_    - - - - - - - - G K L T F P I S V K Q P G P R D F - - L L Q C F I K R C R S A Q T Y R L Y L G L N N A - - - - L - T E D
Os021774_Os05t0    - - - - - - - - G K L T F P L S L K Q P G P R D G - - M I Q C F I K R D K S K S T Y H L Y L C L S T A V - - - L - A D S
Os022386_Os05t0    - - - - - - - - G R I T F P S S L K Q P G P R D A - - P M H C F I R R N K K N S T F Y L Y L S L T Q A - - - - L - T D K
pt001717_POPTR_    - - - - - - - - G C I T F P I S L K Q P G P R D A - - P I Q C F I K R E R A T S T Y H L Y L G L S P A - - - - L S G D M
pt039357_POPTR_    - - - - - - - - G K I T F P V S L K Q P G S R D G - - T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
Os009468_Os02t0    - - - - - - - - G R I T F P I S L K Q P G P R E H - - P V Q C F V R R D R A T S T Y L L Y L G L S P S - - - - L H G E N
Os021773_Os05t0    - - - - - - - - G K L T F P L S L K Q P G P R D G - - M I Q C F I K R D K S K S T Y H L Y L C L S T A V - - - L - A D S
gm021742_Glyma0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - I I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
gm030081_Glyma1    - - - - - - - - G R L T F P I S L K Q P G P R D S - - P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - - E N E T
pt037558_POPTR_    - - - - - - - - G R L T F P I S L K Q P G H R E S - - P I Q C F I K R D T A T S T F L L Y Y G L V P S - - - - - E G E N
Sb030332_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A V - - - L - S E D
Os029490_Os07t0    - - - - - - - - G N L T F P I S L K Q P G P R D A - - P M K C F I V R N R T T Q T Y Y L Y I G L T D A - - - - L - T D D
Sb031457_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A V - - - L - V E S
gm003396_Glyma0    - - - - - - - - G K I T F P V S L K Q P G S R D G - - T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
pp034759_Pp1s15    - - - - - - - - G R L T F P I A L K Q P G P R E N - - T V Q C F I K R D R T T S T Y Q L F L G L P P T - - - - L - V E N
pt002868_POPTR_    - - - - - - - - G K I T F P V S L K Q P G P R D G - - T I Q C F I K R D K S K L T Y H L F L C L S P A L - - - L - V E N
Sb014893_Sorbi1    - - - - - - - - A K L T F P I S L K Q P G P R D G - - V I Q C F I K R D K S K L T Y R L Y L S L S S A V - - - L - D E N
gm045746_Glyma1    - - - - - - - - S N I T F P I S L K Q P G P R E H - - L L Q C F I R R N S A S Q T Y Y L F L S L S S A - - - - L V A D D
gm044959_Glyma1    - - - - - - - - G K I T F P V S L K Q P G S R D G - - T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
gm039266_Glyma1    - - - - - - - - G L L T F P I S L K Q P G P R D S - - P I Q C F I R R E R M T S T Y C L Y L G L S P A - - - - L S G D M
gm028526_Glyma1    - - - - - - - - G K I T F P V S L K Q P G H R D G - - P I Q C F I K R D K S K L T Y H L F L G L S P A L - - - L - V E N
pt025486_POPTR_    S S T N N A S P G K I T F P S C L K Q P G P R D L - - P H Q C L I K R N K K T S T F Y L Y L A L T P S - - - - F - M D K
pp005711_Pp1s21    - - - - - - - - G R L T F P V A L K Q P G P R E D - - T V Q C F I K R D R T T S T Y Q L F L G L P P S - - - - Q - - E N
gm044960_Glyma1    - - - - - - - - G K I T F P V S L K Q P G S R D G - - T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
pt037559_POPTR_    - - - - - - - - G R L T F P I S L K Q P G H R E S - - P I Q C F I K R D T A T S T F L L Y Y G L V P S - - - - - E G E N
gm048089_Glyma1    - - - - - - - - G F I T F P I S L K Q P G P R D S - - P I Q C F I R R E R M T S T Y C L Y L G L S P A - - - - L S G D M
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - M P G P R E N - - L L R C F I K R N R S T Q T Y Y L F L S L T S T - - - - L - A E D
Sb032660_Sorbi1    - - - - - - - - G K L T F P V S L K Q P G P R D G - - M I Q C F I K R D K S K S T Y H L Y L C L S T A V - - - L - M E N
pt028965_POPTR_    N - - N N G S S G K I T F P S C L K Q P G P R D L - - P H Q C L I K R N K K T S T F Y L Y L A L T P S - - - - F - T D K
pp022947_Pp1s22    - - - - - - - - G R L T F P I A L K Q P G P R E N - - T V Q C F I K R D R T T S T Y Q L F L G L P P S - - - - L - V E N
Sm012016_Selmo1    - - - - - - - - G K L T F P I S L K Q P G P R D A - - T M Q C F I K R D R A T S T Y H L C L G L S P N F D A G L - Q E H
gm045744_Glyma1    - - - - - - - - S N I T F P I S L K Q P G P R E H - - L L Q C F I R R N S A S Q T Y Y L F L S L S S A - - - - L V A D D
gm021740_Glyma0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - I I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
pt000711_POPTR_    - - - - - - - - G K I T F P V S L K Q P G P R D G - - T V Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
pt000710_POPTR_    - - - - - - - - G K I T F P V S L K Q P G P R D G - - T V Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
gm045745_Glyma1    - - - - - - - - S N I T F P I S L K Q P G P R E H - - L L Q C F I R R N S A S Q T Y Y L F L S L S S A - - - - L V A D D
gm021741_Glyma0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - I I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
gm041219_Glyma1    - - - - - - - - G K L T F P V S L K Q P G P R D G - - I I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
gm003133_Glyma0    - - - - - - - - G R I T F P I S L K Q P G P R D S - - P I Q C F I R R N K E T S T Y L L Y F G L V P S - - - - - E N D S
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - M Q C F I R R D K S T Q T Y Y L Y L S L G S A V - - - L - V D N
Os019651_Os04t0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - V I Q C F I K R D K S K L T Y H L Y L C L S S A V - - - L - D E T
gm037352_Glyma1    - - - - - - - - G K I T F P A C L K Q P G P R D V - - P H Q C L I K R N K K T S T F Y L Y L A L T P S - - - - F - T D K
gm039265_Glyma1    - - - - - - - - G L L T F P I S L K Q P G P R D S - - P I Q C F I R R E R M T S T Y C L Y L G L S P A - - - - L S G D M
gm003395_Glyma0    - - - - - - - - G K I T F P V S L K Q P G S R D G - - T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
Sb026173_Sorbi1    - - - - - - - - G K L T F P V S L K Q P G P R D G N T M I Q C F I K R N K S K S T Y Y L Y L C L S N V V - - - T - S E S
pt034249_POPTR_    - - - - - - - - G K I T F P I S V K Q P G P R E Q - - L L Q C F I K R C R S T Q T Y R L Y L S L N N A - - - - L - T E D
gm054929_Glyma2    - - - - - - - - G K I T F P V S L K Q P G H R D G - - P I Q C F I K R D K S K L T Y H L F L C L S P A L - - - L - V E N
Os029803_Os08t0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - L I Q C F I K R D K S K L T Y Y L Y L C L S P A V - - - L - S E N
Os019649_Os04t0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - V I Q C F I K R D K S K L T Y H L Y L C L S S A V - - - L - D E T
pt001281_POPTR_    - - - - - - - - G R L T F P I S L K Q P G P R E S - - P I Q C F I K R D N A T S T F L L Y Y G L V P S - - - - - G G E N
Os004869_Os01t0    - - - - - - - - G K L T F P V S I K Q P G P R D G - - M I Q C Y I K R N R S K S T Y H L Y L C L S N V V - - - T - A E G
gm001764_Glyma0    - - - - - - - - G R L T F P I S L K Q P G P R D S - - P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - - E N E T
gm004126_Glyma0    - - - - - - - - G K L T F P I S L K Q P G P R D S - - L L Q C Y I K R N R S N Q T Y Y L F L G L N Q A - - - - S - T D E
Os022387_Os05t0    - - - - - - - - G R I T F P S S L K Q P G P R D A - - P M H C F I R R N K K N S T F Y L Y L S L T Q A - - - - L - T D K
pt037730_POPTR_    - - - - - - - - G C I T F P I S L K Q P G P R D A - - P I Q C F I K R E R A T S T Y L L Y L G L S P A - - - - L S G D M
pp000633_Pp1s10    - - - - - - - - G R L T F P I A L K Q P G P R E N - - T V Q C F I K R D R T T S T Y Q L F L G L P P S - - - - L - I E N
Os029491_Os07t0    - - - - - - - - G N L T F P I S L K Q P G P R D A - - P M K C F I V R N R T T Q T Y Y L Y I G L T D A - - - - L - T D D
gm034540_Glyma1    - - - - - - - - G K I T F P S C L K Q P G P R D V - - P H Q C L I K R N Q K T S T F Y L Y L A L T P S - - - - F - T D K
Sb028483_Sorbi1    - - - - - - - - G K I T F P V S L K Q P G P R D G - - T I Q C F I K R D K S T Q V Y S L Y L S F S S A V - - - P - A E D
gm030080_Glyma1    - - - - - - - - G R L T F P I S L K Q P G P R D S - - P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - - E N E T
pt000712_POPTR_    - - - - - - - - G K I T F P V S L K Q P G P R D G - - T V Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
Os040209_Os12t0    - - - - - - - - G K I T F P V S L K Q P G P R N G - - A I Q C F I K R D K S T Q T Y N L Y L C L S S A V - - - L - V E S
Os009471_Os02t0    - - - - - - - - G R I T F P I S L K Q P G P R E H - - P V Q C F V R R D R A T S T Y L L Y L G L S P S - - - - L H G E N
Sm008088_Selmo1    - - - - - - - - G K L T F P V S L K Q P G P R D A - - T V Q C Y I E R D R T T A T Y R L F L G L T P T - - - - L - T E N
gm036751_Glyma1    - - - - - - - - S K I T F P I S V K Q P G P R E N - - L L R C F I K R N R S T Q T Y Y L F L S L T S T - - - - L - A E D
Sb027814_Sorbi1    - - - - - - - - G R I T F P I S L K Q P G P R D L - - P V Q C F V R R E R A T S T Y L L Y L G L S P S - - - - M N M E N
gm019438_Glyma0    - - - - - - - - S N I T F P I S L K Q P G P R E H - - L L Q C F I R R N S A T Q T Y Y L F L S L S S A - - - - L I A D D
gm003397_Glyma0    - - - - - - - - G K I T F P V S L K Q P G S R D G - - T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
gm021743_Glyma0    - - - - - - - - G K L T F P V S L K Q P G P R D G - - I I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L - V E N
pp034734_Pp1s15    - - - - - - - - G R L T F P I A L K Q P G P R E S - - T V Q C F I K R D R T S S T Y Q L Y L G L P P S - - - - L - V E N
Sb032884_Sorbi1    - - - - - - - - G R I T F P S S L K Q P G P R D A - - P M H C F I R R D K K N S T F S L Y L S L T Q A - - - - L - T D K
gm028527_Glyma1    - - - - - - - - G K I T F P V S L K Q P G H R D G - - P I Q C F I K R D K S K L T Y H L F L G L S P A L - - - L - V E N
gm054928_Glyma2    - - - - - - - - G K I T F P V S L K Q P G H R D G - - P I Q C F I K R D K S K L T Y H L F L C L S P A L - - - L - V E N
 
AT1G25280.1     G K F L L S A K R T R R T T R T E Y I I S M D A D N I S R S S - - N S Y L G K L - - - - - - - - - - - - - - - - - - - -
pp034735_Pp1s15    G K F L L A A R K F R R A A S T D Y I I S L N Q E D I S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm041730_Glyma1    G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - -
Sm016835_Selmo1    G K F L L A A R K F R R A S G T D Y I I S T D T D D F S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm044675_Glyma1    N K L L L A A K R I R R A T G T D F I I S L A A D D F S R A S - - N K Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb024300_Sorbi1    G K F L L A A R R S R R P A G T E Y L I S L D A K N T S K G T C - - - - I G K L - - - - - - - - - - - - - - - - - - - -
pp022942_Pp1s22    G K F L L A A R K C R R A T S T D Y I V S L N H E D M S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
pt000709_POPTR_    G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
pt041132_POPTR_    G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
Os021774_Os05t0    G K F L L S A K R H R K T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Os022386_Os05t0    G K F L L A A R R F R N G A H T E Y I I S Y D C D D L F P G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - -
pt001717_POPTR_    S K L L L A A K K I R K A T S T D F R I S F V G S D F C Q T S - - N T Y A G K L - - - - - - - - - - - - - - - - - - - -
pt039357_POPTR_    G K F L L S A K R K R R T A C T E Y V I S M D A D N V S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Os009468_Os02t0    D K L L L A A R K I R R A T R T S F V I S L V S N D F S L S S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - -
Os021773_Os05t0    G K F L L S A K R H R K T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm021742_Glyma0    G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm030081_Glyma1    D K L L L A A K K V R R A T G T D F I I S L V A D D F S R S S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
pt037558_POPTR_    D K L L L A A R K I R R A T C S D F I V S L V S D D F S R A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb030332_Sorbi1    G K F L L A A K R N R R T T Y T E Y I I S V D R K N I S R S S - - N G Y V G K M - - - - - - - - - - - - - - - - - - - -
Os029490_Os07t0    G K F L L A A R K C R R T T C T E Y L I S L D M N D I S K R T - - D S Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb031457_Sorbi1    G K F L L C A K R T S R P T C T E Y T I F M N S E N L S R S S - - K M Y I G K L - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
pp034759_Pp1s15    G K F L L A A K K F R R P T R T D Y I I S L N H D D M S R G G - - T A Y V G K L - - - - - - - - - - - - - - - - - - - -
pt002868_POPTR_    G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Sb014893_Sorbi1    G K F L L A A K R S R R M A H T E Y A I F M G S R N F S R S S - - T G Y I G K L - - - - - - - - - - - - - - - - - - - -
gm045746_Glyma1    G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
gm044959_Glyma1    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm039266_Glyma1    S K L L L A A K K I R R A T C T E F I I S L V A D D F S R A C - - D T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm028526_Glyma1    G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
pt025486_POPTR_    G K F L L A A R R Y R Q G A H T E Y I I S L D A D E L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
pp005711_Pp1s21    G K F L L A A Q K F R R A T S T D Y I I S L N Q E D M S R G S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm044960_Glyma1    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
pt037559_POPTR_    D K L L L A A R K I R R A T C S D F I V S L V S D D F S R A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm048089_Glyma1    S K L L L A A K K I R R A T C T E F I I S L V S D D F S W A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm036752_Glyma1    G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb032660_Sorbi1    G K F L L S A K R N R K T T C T E Y V I S M D A E N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
pt028965_POPTR_    G K F L L A A R R Y R Q G V H T E Y I I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
pp022947_Pp1s22    G K F L L A A R K F R R A T S T D Y I I S L N Q E N M S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
Sm012016_Selmo1    G K F L L A A R K V R R A T T T D Y I I S L D P E D F S R G S - - T S Y V G K L - - - - - - - - - - - - - - - - - - - -
gm045744_Glyma1    G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S - - N A Y V G K L R S T L N Q I L L L A I L L F L F L S A
gm021740_Glyma0    G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - -
pt000711_POPTR_    G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
pt000710_POPTR_    G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm045745_Glyma1    G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm041219_Glyma1    G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm003133_Glyma0    N K L L L A A K R I R R A T G T G F V I S L A A D D F S R A S - - N K Y V G K L - - - - - - - - - - - - - - - - - - - -
Os037720_Os11t0    G K F L L S A K R N W H A T C T E Y V I S M N A N N L S R S T - - N T N I G K L - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    G K F L L S A K R S R R T T H T D Y I I S M D S K N I S R S S - - S G Y I G K L - - - - - - - - - - - - - - - - - - - -
gm037352_Glyma1    G K F L L A A R R Y R C G T H T E Y I I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
gm039265_Glyma1    S K L L L A A K K I R R A T C T E F I I S L V A D D F S R A C - - D T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm003395_Glyma0    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Sb026173_Sorbi1    G K F L L S A K R H R K T T C T E Y T I S M D S G N I S R S S - - R T Y I G K I - - - - - - - - - - - - - - - - - - - -
pt034249_POPTR_    G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S - - N T Y A G K L - - - - - - - - - - - - - - - - - - - -
gm054929_Glyma2    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Os029803_Os08t0    G K F L L A A K R N R R A T S T E Y I I S V D S K N I S R S S - - N G Y V G K M - - - - - - - - - - - - - - - - - - - -
Os019649_Os04t0    G K F L L S A K R S R R T T H T D Y I I S M D S K N I S R S S - - S G Y I G K L - - - - - - - - - - - - - - - - - - - -
pt001281_POPTR_    D K L L L A A R K I R R A T C T D F I V S L V S D D F S R A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
Os004869_Os01t0    G K F V L A A K R H R K T T C T E Y T I S M V S G N I S R S S - - R T N I G K L - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    D K L L L A A K K V R R A T G T D F V I S L V A D D F F R S S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm004126_Glyma0    G K F L L S A R K C R R A T H T D Y I I S L N C D D V S R G S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Os022387_Os05t0    G K F L L A A R R F R N G A H T E Y I I S Y D C D D L F P G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - -
pt037730_POPTR_    N K V L L A A K K I R K A T S T D F R I S F A G S D F C Q T S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
pp000633_Pp1s10    G K F L L A A R K F R R A T S T D Y I I S L N Q E D M S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
Os029491_Os07t0    G K F L L A A R K C R R T T C T E Y L I S L D M N D I S K R T - - D S Y V G K L - - - - - - - - - - - - - - - - - - - -
gm034540_Glyma1    G K F L L A A R R Y R C G T H T E Y I I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb028483_Sorbi1    G K F L L S A K R N C R P T Y T E Y T I S I N S G D I S R S T S N N T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm030080_Glyma1    D K L L L A A K K V R R A T G T D F I I S L V A D D F S R S S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
pt000712_POPTR_    G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
Os040209_Os12t0    G K F L L S A K R Y S R A T C T E Y T I F M S A D N T S R S S - - N M Y I G K L - - - - - - - - - - - - - - - - - - - -
Os009471_Os02t0    D K L L L A A R K I R R A T R T S F V I S L V S N D F S L S S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - -
Sm008088_Selmo1    G K F L L A A R K S R R A T S T D Y I I S I D P E D M S R G S - - S S C V G K L - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb027814_Sorbi1    D K L L L A A R K V R R A T R T S F V I S L V S D D F S H S S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - -
gm019438_Glyma0    G K F L L A A R K F R R P T C I D Y I I S L D A D D M S R E S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm021743_Glyma0    G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - -
pp034734_Pp1s15    G K F L L A A R K F R R A A S T D Y I I S L N Q E D I S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - -
Sb032884_Sorbi1    G K F L L A A R R F R Q G A H T E Y I I S Y D Y D D L H P R S - - S S Y V G K L - - - - - - - - - - - - - - - - - - - -
gm028527_Glyma1    G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
gm054928_Glyma2    G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - -
 
AT1G25280.1     - - - - - - - - - - R S N F L G T K F L V Y D T Q P P P N T S S S A L I T - D R T S R S R - F H S R R - V S - - P - K V
pp034735_Pp1s15    - - - - - - - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S - - - - N R G A W - R - M G T K Q - L S - - S - R V
gm041730_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D G Q P P H A G A K I M K - - - S R S T R - L - V N L K Q - V S - - P - K V
Sm016835_Selmo1    - - - - - - - - - - R S N F M G T K F T L Y D S N P P H D G A V A S T - - - N R A G R - R - I L S K Q - V S - - P - R V
gm044675_Glyma1    - - - - - - - - - - R S N F L G T K F T I F D S Q A P N D V A I Q P - - N - C Q S S R - R - F H S K Q - V S - - P - R L
Sb024300_Sorbi1    - - - - - - - - - - R S N F L G T K F T V Y D A H P P C T G A V V S K - - - G P S A H - M - I G S A Q - V S - - P - G V
pp022942_Pp1s22    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H S G V V A S - - - - N R G T R - R - L G S K Q - L T - - S - R V
pt000709_POPTR_    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R - R - F Y S K K - V S - - P - K V
pt041132_POPTR_    - - - - - - - - - - R S N F L G T K F T V F D G Q P P H A G A K M T K - - - S R S S R - L - V N L K Q - V S - - P - R V
Os021774_Os05t0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R S S R - R - F N S K K - V S - - P - K M
Os022386_Os05t0    - - - - - - - - - - R S D F L G T K F I I Y D S Q P P Y D G A K P S R - - - S Q S S R - R - F A S K Q - I N - - P - N V
pt001717_POPTR_    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P C P G L K S - - - N - C K L Q Q - K - V R S I Q - V S - - P - G V
pt039357_POPTR_    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R - R - F Y S K K - V S - - P - K V
Os009468_Os02t0    - - - - - - - - - - K P N F L G T K F T I F D S Q P P C D A V V L P - - N - N R P S K - R - - H F K Q - V S - - P - R L
Os021773_Os05t0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R S S R - R - F N S K K - V S - - P - K M
gm021742_Glyma0    - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R - F Y S K K - V S - - P - K V
gm030081_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P - - D - S Q P S R - R - F H S K Q - V S - - P - R V
pt037558_POPTR_    - - - - - - - - - - R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A - N R I S R - R - F H S R Q - V S - - P - R L
Sb030332_Sorbi1    - - - - - - - - - - R S N F L G T K F V V Y D T Q T P H N A G S L L S C E - - R G S R - R - I S S R R - V S - - P - K V
Os029490_Os07t0    - - - - - - - - - - R S N F L G T K F T I Y D A H P P Y A G D V I S K - - - G Q S A R - V - I G S N H - L S - - P - R I
Sb031457_Sorbi1    - - - - - - - - - - R S N L L G T K F A I Y D T Q P P C N T - - - S Q P G - - K T S R - R - F Y S R K - V S - - P - K V
gm003396_Glyma0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R - F Y S K K - V S - - P - K V
pp034759_Pp1s15    - - - - - - - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S - - - - N R G A W - R - M G T K Q - L S - - S - R V
pt002868_POPTR_    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R - F Y S K K - V S - - P - K V
Sb014893_Sorbi1    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N A G K L C A Q E - R A P S R - R - L S S R K - V S - - P - R V
gm045746_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K - - - S C S T E - L V V N S K Q - V S P R P - R V
gm044959_Glyma1    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R - F Y S K K - V S - - P - K V
gm039266_Glyma1    - - - - - - - - - - R S N F L G T K F T I L D G E P P H D S S L P L - - N - C K L Q Q - R - V H L K Q - V L - - P N K V
gm028526_Glyma1    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R - R - F - S K K - V S - - P - K V
pt025486_POPTR_    - - - - - - - - - - S S D F L G T N F T I F D S Q P P H S G A K P S S - - - S R A S R - R - F A S K Q - I S - - P - Q V
pp005711_Pp1s21    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P Q N G P V L S - - - - N R S S R - R - L T S K Q - L S - - Y - R A
gm044960_Glyma1    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R - F Y S K K - V S - - P - K V
pt037559_POPTR_    - - - - - - - - - - R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A - N R I S R - R - F H S R Q - V S - - P - R L
gm048089_Glyma1    - - - - - - - - - - R S N F L G T K F T I L D G E P A H E T S L P L - - N - C K L Q Q - R - V H L K Q - V L - - P N K V
gm036752_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K - - - S R S T R - L - V N L K Q - V S - - P - K V
Sb032660_Sorbi1    - - - - - - - - - - R S N F L G T K F M I S D T Q P P Y N G A V V P H A G - - R T S R - R - F N S K K - V S - - P - K V
pt028965_POPTR_    - - - - - - - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S - - - S R A S R - R - F A S K Q - I S - - P - Q V
pp022947_Pp1s22    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H S G V V A S - - - - N R G T R - R - M G S K Q - L T - - S - R V
Sm012016_Selmo1    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H V G A M P S N - - - S R V G R - R - F G S K Q - I S - - P - R V
gm045744_Glyma1    K T N P L S S H F I R S N F L G T K F T I Y D - - - - - - - - - - R K - - - S C S T E - L V V N S K Q - V S P R P - R V
gm021740_Glyma0    - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R - F Y S K K - V S - - P - K V
pt000711_POPTR_    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R - R - F Y S K K - V S - - P - K V
pt000710_POPTR_    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R - R - F Y S K K - V S - - P - K V
gm045745_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K - - - S C S T E - L V V N S K Q - V S P R P - R V
gm021741_Glyma0    - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R - F Y S K K - V S - - P - K V
gm041219_Glyma1    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y S S A H I C P P G T G K T S R - R - F Y S K K - V S - - P - K V
gm003133_Glyma0    - - - - - - - - - - R S N F L G T K F T V Y D S Q A P H D S A I Q S - - N - C Q S S R - R - F H S K Q - V S - - P - R V
Os037720_Os11t0    - - - - - - - - - - R S N F L G T K F V I Y D T H T P Y N A T S D S Q S G - - K T S R - R - F S N K G - - T - - A - K H
Os019651_Os04t0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E - - R T S R - R - F S S R K - V S - - P - K V
gm037352_Glyma1    - - - - - - - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S - - - G R A S R - R - F A S K Q - I S - - P - Q V
gm039265_Glyma1    - - - - - - - - - - R S N F L G T K F T I L D G E P P H D S S L P L - - N - C K L Q Q - R - V H L K Q - V L - - P N K V
gm003395_Glyma0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R - F Y S K K - V S - - P - K V
Sb026173_Sorbi1    - - - - - - - - - - R S N F L G T R F L I Y D T Q P P Y N G A V V P P S G - - R T S R - R - F N S T K - V S - - P - K L
pt034249_POPTR_    - - - - - - - - - - R S N F L G T K F T V F D G Q P P H A G A K M T K - - - S Y S S R - L - V N L K Q - V S - - P - R V
gm054929_Glyma2    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R - R - F - S K K - V S - - P - K V
Os029803_Os08t0    - - - - - - - - - - R S N F L G T K F V V Y D T Q P P Y N A G S L M S C Q - - H G S R - R - I S S R R - V S - - P - K L
Os019649_Os04t0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E - - R T S R - R - F S S R K - V S - - P - K V
pt001281_POPTR_    - - - - - - - - - - R S N F L G T K F T M Y D S E P T F E V P R Q L - - A - S R T S R - R - F N P R Q - V S - - L - R L
Os004869_Os01t0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N G A V V P H V G - - R T S K - R - F N S T K - V S - - P - K V
gm001764_Glyma0    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P Q G A A I Q P - - D - N R S S R - R - F H S K Q - V S - - P - R V
gm004126_Glyma0    - - - - - - - - - - R S N F L G T K F T V Y D A H P P I Y G A K V T K - - - S R S T R - L - V S L K Q - V S - - P - R V
Os022387_Os05t0    - - - - - - - - - - R S D F L G T K F I I Y D S Q P P Y D G A K P S R - - - S Q S S R - R - F A S K Q - I N - - P - N V
pt037730_POPTR_    - - - - - - - - - - R S N F L G T K F T I Y D G Q T P C P A M R S - - - N - C K P Q R - K - V R S I Q - V S - - P - G V
pp000633_Pp1s10    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H N R G V A S - - - - N R S S R - R - I G S K Q - L T - - S - R V
Os029491_Os07t0    - - - - - - - - - - R S N F L G T K F T I Y D A H P P Y A G D V I S K - - - G Q S A R - V - I G S N H - L S - - P - R I
gm034540_Glyma1    - - - - - - - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S - - - G R A S R - R - F A S K Q - I S - - P - Q V
Sb028483_Sorbi1    - - - - - - - - - - R S N F L G T K F V I Y D T Q P P Y N A T S P T V A G - - K T N Q - R - F Y S K K G G S - - T - K G
gm030080_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P - - D - S Q P S R - R - F H S K Q - V S - - P - R V
pt000712_POPTR_    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R - R - F Y S K K - V S - - P - K V
Os040209_Os12t0    - - - - - - - - - - R S N L L G T K F V I Y D T Q P P C N T A N V S Q S G - - K T S R - R - F Y S R K - V S - - P - K N
Os009471_Os02t0    - - - - - - - - - - K P N F L G T K F T I F D S Q P P C D A V V L P - - N - N R P S K - R - - H F K Q - V S - - P - R L
Sm008088_Selmo1    - - - - - - - - - - R S N F L G T K F A I Y D T Q P P H S G A I A S T - - - N R A G R - R - V A A K Q - V S - - P - K V
gm036751_Glyma1    - - - - - - - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K - - - S R S T R - L - V N L K Q - V S - - P - K V
Sb027814_Sorbi1    - - - - - - - - - - K P N F L G T K F T I F D S Q P P P D A V V L P - - N - N K P S K - R - - Q S K Q - V S - - P - R L
gm019438_Glyma0    - - - - - - - - - - R S N F L G T K F T I Y D I P L P H V G A K M T K - - - S C F T K - L - V N P K Q - V S - - P - R V
gm003397_Glyma0    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R - F Y S K K - V S - - P - K V
gm021743_Glyma0    - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R - F Y S K K - V S - - P - K V
pp034734_Pp1s15    - - - - - - - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S - - - - N R G A W - R - M G T K Q - L S - - S - R V
Sb032884_Sorbi1    - - - - - - - - - - R S D F L G T K F I I Y D S Q A P Y D G A K P S R - - - S R S T R - R - F A S K Q - I S - - P - Q V
gm028527_Glyma1    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R - R - F - S K K - V S - - P - K V
gm054928_Glyma2    - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R - R - F - S K K - V S - - P - K V
 
AT1G25280.1     - P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M H C I M N S I P I S S - L E P - - - G G S - - - V P N Q
pp034735_Pp1s15    - H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A - M E S - - - G G S - - - A P T P
gm041730_Glyma1    - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A A A - I E P - - - G G V - - - A P V Q
Sm016835_Selmo1    - P A G S Y N I A H I A Y E L N V L G T R G P - - - - - - R R M E C T I H S I P A S A - M E P - - - G G C - - - A P T P
gm044675_Glyma1    - P A C N Y L V S T V S Y E L N V L C T R G P - - - - - - R R M Y C V M N S I P V S A - I Q E - - - G G N - - - A P T P
Sb024300_Sorbi1    - P A G N Y P I S H I S Y E A T - F G S R Y P - - - - - - R K M N C V M D S I P L