fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G25280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Pt000712 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt000711 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt000710 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt000709 not found in 424aa AT1G76900.2 not_not 0.706874189 III
Pt039357 not found in 424aa AT1G76900.2 not_not 0.700389105 III
Pt037559 not found in 416aa AT2G18280.2 not_not 0.526588845 III
Pt037558 not found in 416aa AT2G18280.2 not_not 0.526588845 III
Pt041132 not found in 392aa AT2G47900.2 not_not 0.525291828 III
Pt001717 not found in 416aa AT1G47270.1 not_not 0.525291828 III
Pt037730 not found in 416aa AT1G47270.1 not_not 0.520103761 III
Pt034249 not found in 395aa AT2G47900.2 not_not 0.517509727 III
Pt001281 not found in 414aa AT2G18280.2 not_not 0.499351491 III
Pt028965 not found in 377aa AT1G53320.1 not_not 0.412451361 III
Pt025486 not found in 379aa AT1G53320.1 not_not 0.411154345 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G25280.1     -MSFRGIVQDL---RDGFGSLSRRS----------FDFRLSSLHKGKAQGSSFREYSSSR
pt028965_POPTR_ -MSLR---------RSFLSRRFSRS----------FNNQNRNERNGVESGRLVG------
pt037559_POPTR_ -MSIKSIVRELKEMKDGIGNISRRG-LEGKHWRGRARSHIAPD-----------------
pt039357_POPTR_ -MSFRSIVRDM---RDGFGSLSRRS----------FEVRLPGHLRGKSHGSAC-------
pt000710_POPTR_ -MSFRSIVRDM---RDGFGSLSRRS----------FEVRLPGHFRGKSHGSAC-------
pt037730_POPTR_ -MSFKG---KLKEIRDDISTTFSMGKLQRNRTNRRGRAYIAPEL-----GGGS-------
pt000712_POPTR_ -MSFRSIVRDM---RDGFGSLSRRS----------FEVRLPGHFRGKSHGSAC-------
pt001717_POPTR_ -MSFKS---KLKEIRDDITTTFSMGKLQRNRTNRRGRAYIAPEL-----GGGS-------
pt041132_POPTR_ MSAIKSIINR---------SRSHRV----------VQYSSAPDLSLFGGGCGA-------
pt034249_POPTR_ MPALKSIINR---------STSHRV----------VQYSSAPELNLFAAGGAA-------
pt000711_POPTR_ -MSFRSIVRDM---RDGFGSLSRRS----------FEVRLPGHFRGKSHGSAC-------
pt037558_POPTR_ -MSIKSIVRELKEMKDGIGNISRRG-LEGKHWRGRARSHIAPD-----------------
pt000709_POPTR_ -MSFRSIVRDM---RDGFGSLSRRS----------FEVRLPGHFRGKSHGSAC-------
pt025486_POPTR_ -MSLR---------RSILSRRFSRS----------FNNQNRNERNAVESGRLGG------
pt001281_POPTR_ -MSFKSIMREFKEIKEGIGSISRRG-VEGKHWCGRVRSHIAPD-----------------
                  :::                                                       

AT1G25280.1     DLL-SPVIVQTSRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSWRAMCQEIV
pt028965_POPTR_ ESGG-----ESDGWGSMLPELLGEIIKRVEESEDRWPQRQNVVACACVCKKWREVTKDIV
pt037559_POPTR_ ETPAETDQIEQGQWANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSWREITKEIV
pt039357_POPTR_ ELQDQPVVIQNSRWAGLPPELLQDVIKRLEASESTWPSRKHVVACASVCRAWREMCKEIV
pt000710_POPTR_ ELLDQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIV
pt037730_POPTR_ ELFRELIE-EQSPWANLPPELLHDVIQRVEGSETSWPGRRDVVACASVCKSWREITKTVV
pt000712_POPTR_ ELLDQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIV
pt001717_POPTR_ ELLSELIE-EQSPWANLPPELLQDVIKRVEGSETSWPGRRDVVACASVCTSWREITKAVV
pt041132_POPTR_ ETT--------SCWANLPQELLREVLIRIEESESSWPPRKNVVACAGVCRSWRDITKELV
pt034249_POPTR_ ETA--------SCWANLPQELLREVLVRIEESESSWPPRKNVVACAGVCRSWRHITKDLV
pt000711_POPTR_ ELLDQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIV
pt037558_POPTR_ ETPAETDQIEQGQWANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSWREITKEIV
pt000709_POPTR_ ELLDQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIV
pt025486_POPTR_ ELWA-----ESDGWGSMLPELLGEIIKRVEESEDRWPQRQSVVACACVCKKWRDVTKDIV
pt001281_POPTR_ ETREETDQIDQGQWANLPPELLLDIIMRLEESESSWPARVVVVHCASVCRSWREITKEIV
                :          . *..:  *** ::: *:* **  ** *  ** ** **  ** : : :*

AT1G25280.1     L---------GPEICGKLTFPVSLKQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVE
pt028965_POPTR_ KSLPNNNN--NNGSSGKITFPSCLKQPGPRDLPHQCLIKRNKKTSTFYLYLALTPS-FTD
pt037559_POPTR_ K---------TPEQCGRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-EGE
pt039357_POPTR_ R---------SPEFSGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVE
pt000710_POPTR_ R---------SPEFSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVE
pt037730_POPTR_ K---------TPEQCGCITFPISLKQPGPRDAPIQCFIKRERATSTYLLYLGLSPALSGD
pt000712_POPTR_ R---------SPEFSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVE
pt001717_POPTR_ K---------TPEQCGCITFPISLKQPGPRDAPIQCFIKRERATSTYHLYLGLSPALSGD
pt041132_POPTR_ K---------VPELSGKLTFPISVKQPGPRDFLLQCFIKRCRSAQTYRLYLGLNNA-LTE
pt034249_POPTR_ K---------VPELSGKITFPISVKQPGPREQLLQCFIKRCRSTQTYRLYLSLNNA-LTE
pt000711_POPTR_ R---------SPEFSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVE
pt037558_POPTR_ K---------TPEQCGRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-EGE
pt000709_POPTR_ R---------SPEFSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVE
pt025486_POPTR_ KSLPNSSSSTNNASPGKITFPSCLKQPGPRDLPHQCLIKRNKKTSTFYLYLALTPS-FMD
pt001281_POPTR_ K---------TPEQCGRLTFPISLKQPGPRESPIQCFIKRDNATSTFLLYYGLVPS-GGE
                               * :*** .:**** *:   **:***     *: *:  *  :   :

AT1G25280.1     NGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGTKFLVYDTQP----P
pt028965_POPTR_ KGKFLLAARRYRQGVHTEYIISLDADDLSQGSNAYVGKLSSDFLGTNFTIYDSQP----P
pt037559_POPTR_ NDKLLLAARKIRRATCSDFIVSLVSDDFSRASNTYVGKLRSNFLGTKFTMYDCEPTFEVP
pt039357_POPTR_ NGKFLLSAKRKRRTACTEYVISMDADNVSRSSSTYIGKLRSNFLGTKFIIYDTQP----P
pt000710_POPTR_ NGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQP----P
pt037730_POPTR_ MNKVLLAAKKIRKATSTDFRISFAGSDFCQTSNTYVGKLRSNFLGTKFTIYDGQT----P
pt000712_POPTR_ NGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQP----P
pt001717_POPTR_ MSKLLLAAKKIRKATSTDFRISFVGSDFCQTSNTYAGKLRSNFLGTKFTIYDSQP----P
pt041132_POPTR_ DGKFLLAARKCRRPTCTDYIISLDTDDMSKGSNAYVGKLRSNFLGTKFTVFDGQP----P
pt034249_POPTR_ DGKFLLAARKCRRPTCTDYIISLDTDDMSKGSNTYAGKLRSNFLGTKFTVFDGQP----P
pt000711_POPTR_ NGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQP----P
pt037558_POPTR_ NDKLLLAARKIRRATCSDFIVSLVSDDFSRASNTYVGKLRSNFLGTKFTMYDCEPTFEVP
pt000709_POPTR_ NGKFLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQP----P
pt025486_POPTR_ KGKFLLAARRYRQGAHTEYIISLDADELSQGSNAYVGKLSSDFLGTNFTIFDSQP----P
pt001281_POPTR_ NDKLLLAARKIRRATCTDFIVSLVSDDFSRASNTYVGKLRSNFLGTKFTMYDSEPTFEVP
                 .*.**:*:: *: . ::: :*:  .:..: *.:* *** *:****:* ::* :.    *

AT1G25280.1     PNTSSSALITDRTSRS-RFHSRRVSPKVPSGSYNIAQITYELNVLGTRGPRRMHCIMNSI
pt028965_POPTR_ HSGAKPS----SSRASRRFASKQISPQVPAGNFEVGQVSYKFNLLKSRGPRRMVCSLK--
pt037559_POPTR_ TQTQHAN------RISRRFHSRQVSPRLPACNYSIGTITYELNVLRSRGPRRMHCMMHSI
pt039357_POPTR_ YNNAQLA----PPGRSRRFYSKKVSPKVPTGSYNIAQVTYELNVLGTRGPRRMHCTMHSI
pt000710_POPTR_ YNNAQLA----PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSI
pt037730_POPTR_ CPAMRSN-----CKPQRKVRSIQVSPGVAARNYNVATVSYELNVLRTRGPRRMHCTIHSI
pt000712_POPTR_ YNNAQLA----PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSI
pt001717_POPTR_ CPGLKSN-----CKLQQKVRSIQVSPGVPARNFNVATVSYELNVLRTRGPRRMHCIVHSI
pt041132_POPTR_ HAGAKMT----KSRSSRLVNLKQVSPRVPTGNYPVASISYELNVLGSRGPRRMHCIMDAI
pt034249_POPTR_ HAGAKMT----KSYSSRLVNLKQVSPRVPTGNYPVANISYELNVLGSRGPRRMHCIMDAI
pt000711_POPTR_ YNNAQLA----PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSI
pt037558_POPTR_ TQTQHAN------RISRRFHSRQVSPRLPACNYSIGTITYELNVLRSRGPRRMHCMMHSI
pt000709_POPTR_ YNNAQLA----PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSI
pt025486_POPTR_ HSGAKPS----SSRASRRFASKQISPQVPAGNFEVGQVSYKFNLLKSRGPRRMVCSLK--
pt001281_POPTR_ RQL--AS------RTSRRFNPRQVSLRLPACNYCIATITYELNVLRSRGPRRMHCIMHSI
                               .  .   ::*  :.: .: :. ::*::*:* :****** * :.  

AT1G25280.1     PISSLEPGGSVPNQPEKLV--PAPYSLDDSFRSNISFSKSSFDH---RSLDFSSSRFSEM
pt028965_POPTR_ ----------CPVSQETTNVKN------------VDNSK---------MTQLESASSGFT
pt037559_POPTR_ PMSSIEEGGTVPTLTSLT------ETFGGQFPH-LSTSK-GKES----VSDISSPSPSQS
pt039357_POPTR_ PALSLEPGGSVPGQPELL-----PRCLEDSFRS-ISFSK-SIDN----STEFSSSRFSDI
pt000710_POPTR_ PVSSLEPGGSVPGQPELL-----PCSLEDSFRS-ISFSK-SIDN----STEFSSSRFSNI
pt037730_POPTR_ PISAIQEGGIAPTPSEFN------NPSNEQSSP-LSASK-LKQP----PIDFSSNSLAES
pt000712_POPTR_ PVSSLEPGGSVPGQPELL-----PCSLEDSFRS-ISFSK-SIDN----STEFSSSRFSNI
pt001717_POPTR_ PISAIQEGGVAPTPLEFN------NPGDEQSPS-LSASK-VKQP----LIDFISTSRAES
pt041132_POPTR_ PASAIEPGGIAPTQTEFS------HHNVDFLPS-LPFFR-SKSN---RVESFQSGSLSSQ
pt034249_POPTR_ PAAAIEPGGVAPTQTEFY------HHSADFFPS-LLFFR-SKSNRVERVESFQSGPLSSQ
pt000711_POPTR_ PVSSLEPGGSVPGQPELL-----PCSLEDSFRS-ISFSK-SIDN----STEFSSSRFSNI
pt037558_POPTR_ PMSSIEEGGTVPTLTSLT------ETFGGQFPH-LSTSK-GKES----VSDISSPSPSQS
pt000709_POPTR_ PVSSLEPGGSVPGQPELL-----PCSLEDSFRS-ISFSK-SIDN----STEFSSSRFSNI
pt025486_POPTR_ ----------CPVLQETINDKI------------LDNSK---------MNGLESASSGCT
pt001281_POPTR_ PMSSIEEGGTVQTLTSIP------EAFNGQFPH-LSSSI-GKEL----VSDNSSASPSRS
                               .                  :                  *   .  

AT1G25280.1     GISCDDNEEEASFRPLILKNKQPRWHEQLQCWCLNFRGRVTVASVKNFQLVAARQPQPQG
pt028965_POPTR_ ----------------VLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLVAIMDQ----
pt037559_POPTR_ -----PVLTQGSEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVESFH--
pt039357_POPTR_ -VGPREEDEEGKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQP----
pt000710_POPTR_ -VGPREEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQP----
pt037730_POPTR_ -----SDSLCSKNDPLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPCQ--
pt000712_POPTR_ -VGPREEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQP----
pt001717_POPTR_ -----SDSICSKMDPLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPCQ--
pt041132_POPTR_ -----------REGALVLKNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLVVSPE-----
pt034249_POPTR_ -----------REGALVLRNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLVASQE-----
pt000711_POPTR_ -VGPREEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQP----
pt037558_POPTR_ -----PVLTQGSEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVESFH--
pt000709_POPTR_ -VGPREEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQP----
pt025486_POPTR_ ----------------VLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLVATMDQ----
pt001281_POPTR_ -----PVLAQGSEELLVLKNKAPRWHEQLQCSCLNFRGRVTVASVKNFQLVASAEPSH--
                                :*:** *****:*** ****:***:*********:.  :     

AT1G25280.1     TGAAAAPT-SAPAHP-EQDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
pt028965_POPTR_ ---------SQPGGKGDEETVLLQFGKVGDDTFTMDYRQPLSAFQAFALCLTSFGTKLAC
pt037559_POPTR_ ---------NVSSA--DQERVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPAC
pt039357_POPTR_ --AAGAPTPSQPAQS-DHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
pt000710_POPTR_ --AAGAPTPSQPAQS-DHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
pt037730_POPTR_ ---------NVPVE--EQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPAC
pt000712_POPTR_ --AAGAPTPSQPAQS-DHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
pt001717_POPTR_ ---------NVPVE--EQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPAC
pt041132_POPTR_ ---------NGPAGP-EHENIILQFGKVGKDLFTMDYRYPISAFQAFALCLSSFDTKIAC
pt034249_POPTR_ ---------NGPAGP-EHENIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTKIAC
pt000711_POPTR_ --AAGAPTPSQPAQS-DHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
pt037558_POPTR_ ---------NVSSA--DQERVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPAC
pt000709_POPTR_ --AAGAPTPSQPAQS-DHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
pt025486_POPTR_ ---------SQPGGRGDEDTVLLQFGKVGEDTFTMDYRLPLSAFQAFAICLTSFGTKLAC
pt001281_POPTR_ ---------NVPAA--DQERVILQFGKIGKDIFTMDYFYPLSAFQAFAICLSSFDTKPAC
                         . .    :.: ::*****:*.* *****  *:*******:**:**.** **

AT1G25280.1     E
pt028965_POPTR_ E
pt037559_POPTR_ E
pt039357_POPTR_ E
pt000710_POPTR_ E
pt037730_POPTR_ E
pt000712_POPTR_ E
pt001717_POPTR_ E
pt041132_POPTR_ E
pt034249_POPTR_ E
pt000711_POPTR_ E
pt037558_POPTR_ E
pt000709_POPTR_ E
pt025486_POPTR_ E
pt001281_POPTR_ E
                *


BoxShade v3.31 C (beta, 970507) Output
AT1G25280.1     - M S F R G I V Q D L - - - R D G F G S L S R R S - - - - - - - - - - F D F R L S S L H K G K A Q G S S F R E Y S S S R
pt028965_POPTR_    - M S L R - - - - - - - - - R S F L S R R F S R S - - - - - - - - - - F N N Q N R N E R N G V E S G R L V G - - - - - -
pt037559_POPTR_    - M S I K S I V R E L K E M K D G I G N I S R R G - L E G K H W R G R A R S H I A P D - - - - - - - - - - - - - - - - -
pt039357_POPTR_    - M S F R S I V R D M - - - R D G F G S L S R R S - - - - - - - - - - F E V R L P G H L R G K S H G S A C - - - - - - -
pt000710_POPTR_    - M S F R S I V R D M - - - R D G F G S L S R R S - - - - - - - - - - F E V R L P G H F R G K S H G S A C - - - - - - -
pt037730_POPTR_    - M S F K G - - - K L K E I R D D I S T T F S M G K L Q R N R T N R R G R A Y I A P E L - - - - - G G G S - - - - - - -
pt000712_POPTR_    - M S F R S I V R D M - - - R D G F G S L S R R S - - - - - - - - - - F E V R L P G H F R G K S H G S A C - - - - - - -
pt001717_POPTR_    - M S F K S - - - K L K E I R D D I T T T F S M G K L Q R N R T N R R G R A Y I A P E L - - - - - G G G S - - - - - - -
pt041132_POPTR_    M S A I K S I I N R - - - - - - - - - S R S H R V - - - - - - - - - - V Q Y S S A P D L S L F G G G C G A - - - - - - -
pt034249_POPTR_    M P A L K S I I N R - - - - - - - - - S T S H R V - - - - - - - - - - V Q Y S S A P E L N L F A A G G A A - - - - - - -
pt000711_POPTR_    - M S F R S I V R D M - - - R D G F G S L S R R S - - - - - - - - - - F E V R L P G H F R G K S H G S A C - - - - - - -
pt037558_POPTR_    - M S I K S I V R E L K E M K D G I G N I S R R G - L E G K H W R G R A R S H I A P D - - - - - - - - - - - - - - - - -
pt000709_POPTR_    - M S F R S I V R D M - - - R D G F G S L S R R S - - - - - - - - - - F E V R L P G H F R G K S H G S A C - - - - - - -
pt025486_POPTR_    - M S L R - - - - - - - - - R S I L S R R F S R S - - - - - - - - - - F N N Q N R N E R N A V E S G R L G G - - - - - -
pt001281_POPTR_    - M S F K S I M R E F K E I K E G I G S I S R R G - V E G K H W C G R V R S H I A P D - - - - - - - - - - - - - - - - -
 
AT1G25280.1     D L L - S P V I V Q T S R W A N L P P E L L F D V I K R L E E S E S N W P A R K H V V A C A S V C R S W R A M C Q E I V
pt028965_POPTR_    E S G G - - - - - E S D G W G S M L P E L L G E I I K R V E E S E D R W P Q R Q N V V A C A C V C K K W R E V T K D I V
pt037559_POPTR_    E T P A E T D Q I E Q G Q W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W R E I T K E I V
pt039357_POPTR_    E L Q D Q P V V I Q N S R W A G L P P E L L Q D V I K R L E A S E S T W P S R K H V V A C A S V C R A W R E M C K E I V
pt000710_POPTR_    E L L D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V
pt037730_POPTR_    E L F R E L I E - E Q S P W A N L P P E L L H D V I Q R V E G S E T S W P G R R D V V A C A S V C K S W R E I T K T V V
pt000712_POPTR_    E L L D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V
pt001717_POPTR_    E L L S E L I E - E Q S P W A N L P P E L L Q D V I K R V E G S E T S W P G R R D V V A C A S V C T S W R E I T K A V V
pt041132_POPTR_    E T T - - - - - - - - S C W A N L P Q E L L R E V L I R I E E S E S S W P P R K N V V A C A G V C R S W R D I T K E L V
pt034249_POPTR_    E T A - - - - - - - - S C W A N L P Q E L L R E V L V R I E E S E S S W P P R K N V V A C A G V C R S W R H I T K D L V
pt000711_POPTR_    E L L D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V
pt037558_POPTR_    E T P A E T D Q I E Q G Q W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W R E I T K E I V
pt000709_POPTR_    E L L D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V
pt025486_POPTR_    E L W A - - - - - E S D G W G S M L P E L L G E I I K R V E E S E D R W P Q R Q S V V A C A C V C K K W R D V T K D I V
pt001281_POPTR_    E T R E E T D Q I D Q G Q W A N L P P E L L L D I I M R L E E S E S S W P A R V V V V H C A S V C R S W R E I T K E I V
 
AT1G25280.1     L - - - - - - - - - G P E I C G K L T F P V S L K Q P G P R D A M I Q C F I K R D K S K L T F H L F L C L S P A L L V E
pt028965_POPTR_    K S L P N N N N - - N N G S S G K I T F P S C L K Q P G P R D L P H Q C L I K R N K K T S T F Y L Y L A L T P S - F T D
pt037559_POPTR_    K - - - - - - - - - T P E Q C G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S - E G E
pt039357_POPTR_    R - - - - - - - - - S P E F S G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E
pt000710_POPTR_    R - - - - - - - - - S P E F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E
pt037730_POPTR_    K - - - - - - - - - T P E Q C G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y L L Y L G L S P A L S G D
pt000712_POPTR_    R - - - - - - - - - S P E F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E
pt001717_POPTR_    K - - - - - - - - - T P E Q C G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y H L Y L G L S P A L S G D
pt041132_POPTR_    K - - - - - - - - - V P E L S G K L T F P I S V K Q P G P R D F L L Q C F I K R C R S A Q T Y R L Y L G L N N A - L T E
pt034249_POPTR_    K - - - - - - - - - V P E L S G K I T F P I S V K Q P G P R E Q L L Q C F I K R C R S T Q T Y R L Y L S L N N A - L T E
pt000711_POPTR_    R - - - - - - - - - S P E F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E
pt037558_POPTR_    K - - - - - - - - - T P E Q C G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S - E G E
pt000709_POPTR_    R - - - - - - - - - S P E F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E
pt025486_POPTR_    K S L P N S S S S T N N A S P G K I T F P S C L K Q P G P R D L P H Q C L I K R N K K T S T F Y L Y L A L T P S - F M D
pt001281_POPTR_    K - - - - - - - - - T P E Q C G R L T F P I S L K Q P G P R E S P I Q C F I K R D N A T S T F L L Y Y G L V P S - G G E
 
AT1G25280.1     N G K F L L S A K R T R R T T R T E Y I I S M D A D N I S R S S N S Y L G K L R S N F L G T K F L V Y D T Q P - - - - P
pt028965_POPTR_    K G K F L L A A R R Y R Q G V H T E Y I I S L D A D D L S Q G S N A Y V G K L S S D F L G T N F T I Y D S Q P - - - - P
pt037559_POPTR_    N D K L L L A A R K I R R A T C S D F I V S L V S D D F S R A S N T Y V G K L R S N F L G T K F T M Y D C E P T F E V P
pt039357_POPTR_    N G K F L L S A K R K R R T A C T E Y V I S M D A D N V S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P - - - - P
pt000710_POPTR_    N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P - - - - P
pt037730_POPTR_    M N K V L L A A K K I R K A T S T D F R I S F A G S D F C Q T S N T Y V G K L R S N F L G T K F T I Y D G Q T - - - - P
pt000712_POPTR_    N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P - - - - P
pt001717_POPTR_    M S K L L L A A K K I R K A T S T D F R I S F V G S D F C Q T S N T Y A G K L R S N F L G T K F T I Y D S Q P - - - - P
pt041132_POPTR_    D G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N A Y V G K L R S N F L G T K F T V F D G Q P - - - - P
pt034249_POPTR_    D G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N T Y A G K L R S N F L G T K F T V F D G Q P - - - - P
pt000711_POPTR_    N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P - - - - P
pt037558_POPTR_    N D K L L L A A R K I R R A T C S D F I V S L V S D D F S R A S N T Y V G K L R S N F L G T K F T M Y D C E P T F E V P
pt000709_POPTR_    N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P - - - - P
pt025486_POPTR_    K G K F L L A A R R Y R Q G A H T E Y I I S L D A D E L S Q G S N A Y V G K L S S D F L G T N F T I F D S Q P - - - - P
pt001281_POPTR_    N D K L L L A A R K I R R A T C T D F I V S L V S D D F S R A S N T Y V G K L R S N F L G T K F T M Y D S E P T F E V P
 
AT1G25280.1     P N T S S S A L I T D R T S R S - R F H S R R V S P K V P S G S Y N I A Q I T Y E L N V L G T R G P R R M H C I M N S I
pt028965_POPTR_    H S G A K P S - - - - S S R A S R R F A S K Q I S P Q V P A G N F E V G Q V S Y K F N L L K S R G P R R M V C S L K - -
pt037559_POPTR_    T Q T Q H A N - - - - - - R I S R R F H S R Q V S P R L P A C N Y S I G T I T Y E L N V L R S R G P R R M H C M M H S I
pt039357_POPTR_    Y N N A Q L A - - - - P P G R S R R F Y S K K V S P K V P T G S Y N I A Q V T Y E L N V L G T R G P R R M H C T M H S I
pt000710_POPTR_    Y N N A Q L A - - - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I
pt037730_POPTR_    C P A M R S N - - - - - C K P Q R K V R S I Q V S P G V A A R N Y N V A T V S Y E L N V L R T R G P R R M H C T I H S I
pt000712_POPTR_    Y N N A Q L A - - - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I
pt001717_POPTR_    C P G L K S N - - - - - C K L Q Q K V R S I Q V S P G V P A R N F N V A T V S Y E L N V L R T R G P R R M H C I V H S I
pt041132_POPTR_    H A G A K M T - - - - K S R S S R L V N L K Q V S P R V P T G N Y P V A S I S Y E L N V L G S R G P R R M H C I M D A I
pt034249_POPTR_    H A G A K M T - - - - K S Y S S R L V N L K Q V S P R V P T G N Y P V A N I S Y E L N V L G S R G P R R M H C I M D A I
pt000711_POPTR_    Y N N A Q L A - - - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I
pt037558_POPTR_    T Q T Q H A N - - - - - - R I S R R F H S R Q V S P R L P A C N Y S I G T I T Y E L N V L R S R G P R R M H C M M H S I
pt000709_POPTR_    Y N N A Q L A - - - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I
pt025486_POPTR_    H S G A K P S - - - - S S R A S R R F A S K Q I S P Q V P A G N F E V G Q V S Y K F N L L K S R G P R R M V C S L K - -
pt001281_POPTR_    R Q L - - A S - - - - - - R T S R R F N P R Q V S L R L P A C N Y C I A T I T Y E L N V L R S R G P R R M H C I M H S I
 
AT1G25280.1     P I S S L E P G G S V P N Q P E K L V - - P A P Y S L D D S F R S N I S F S K S S F D H - - - R S L D F S S S R F S E M
pt028965_POPTR_    - - - - - - - - - - C P V S Q E T T N V K N - - - - - - - - - - - - V D N S K - - - - - - - - - M T Q L E S A S S G F T
pt037559_POPTR_    P M S S I E E G G T V P T L T S L T - - - - - - E T F G G Q F P H - L S T S K - G K E S - - - - V S D I S S P S P S Q S
pt039357_POPTR_    P A L S L E P G G S V P G Q P E L L - - - - - P R C L E D S F R S - I S F S K - S I D N - - - - S T E F S S S R F S D I
pt000710_POPTR_    P V S S L E P G G S V P G Q P E L L - - - - - P C S L E D S F R S - I S F S K - S I D N - - - - S T E F S S S R F S N I
pt037730_POPTR_    P I S A I Q E G G I A P T P S E F N - - - - - - N P S N E Q S S P - L S A S K - L K Q P - - - - P I D F S S N S L A E S
pt000712_POPTR_    P V S S L E P G G S V P G Q P E L L - - - - - P C S L E D S F R S - I S F S K - S I D N - - - - S T E F S S S R F S N I
pt001717_POPTR_    P I S A I Q E G G V A P T P L E F N - - - - - - N P G D E Q S P S - L S A S K - V K Q P - - - - L I D F I S T S R A E S
pt041132_POPTR_    P A S A I E P G G I A P T Q T E F S - - - - - - H H N V D F L P S - L P F F R - S K S N - - - R V E S F Q S G S L S S Q
pt034249_POPTR_    P A A A I E P G G V A P T Q T E F Y - - - - - - H H S A D F F P S - L L F F R - S K S N R V E R V E S F Q S G P L S S Q
pt000711_POPTR_    P V S S L E P G G S V P G Q P E L L - - - - - P C S L E D S F R S - I S F S K - S I D N - - - - S T E F S S S R F S N I
pt037558_POPTR_    P M S S I E E G G T V P T L T S L T - - - - - - E T F G G Q F P H - L S T S K - G K E S - - - - V S D I S S P S P S Q S
pt000709_POPTR_    P V S S L E P G G S V P G Q P E L L - - - - - P C S L E D S F R S - I S F S K - S I D N - - - - S T E F S S S R F S N I
pt025486_POPTR_    - - - - - - - - - - C P V L Q E T I N D K I - - - - - - - - - - - - L D N S K - - - - - - - - - M N G L E S A S S G C T
pt001281_POPTR_    P M S S I E E G G T V Q T L T S I P - - - - - - E A F N G Q F P H - L S S S I - G K E L - - - - V S D N S S A S P S R S
 
AT1G25280.1     G I S C D D N E E E A S F R P L I L K N K Q P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A R Q P Q P Q G
pt028965_POPTR_    - - - - - - - - - - - - - - - - V L R N K A P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A I M D Q - - - -
pt037559_POPTR_    - - - - - P V L T Q G S E E P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A V E S F H - -
pt039357_POPTR_    - V G P R E E D E E G K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P - - - -
pt000710_POPTR_    - V G P R E E D E E G K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P - - - -
pt037730_POPTR_    - - - - - S D S L C S K N D P L I L K N K A P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A V E P C Q - -
pt000712_POPTR_    - V G P R E E D E E G K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P - - - -
pt001717_POPTR_    - - - - - S D S I C S K M D P L V L K N K A P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A V E P C Q - -
pt041132_POPTR_    - - - - - - - - - - - R E G A L V L K N K A P R W H E Q L Q C W C L N F H G R V T V A S V K N F Q L V V S P E - - - - -
pt034249_POPTR_    - - - - - - - - - - - R E G A L V L R N K A P R W H E Q L Q C W C L N F H G R V T V A S V K N F Q L V A S Q E - - - - -
pt000711_POPTR_    - V G P R E E D E E G K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P - - - -
pt037558_POPTR_    - - - - - P V L T Q G S E E P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A V E S F H - -
pt000709_POPTR_    - V G P R E E D E E G K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P - - - -
pt025486_POPTR_    - - - - - - - - - - - - - - - - V L R N K A P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A T M D Q - - - -
pt001281_POPTR_    - - - - - P V L A Q G S E E L L V L K N K A P R W H E Q L Q C S C L N F R G R V T V A S V K N F Q L V A S A E P S H - -
 
AT1G25280.1     T G A A A A P T - S A P A H P - E Q D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
pt028965_POPTR_    - - - - - - - - - S Q P G G K G D E E T V L L Q F G K V G D D T F T M D Y R Q P L S A F Q A F A L C L T S F G T K L A C
pt037559_POPTR_    - - - - - - - - - N V S S A - - D Q E R V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C
pt039357_POPTR_    - - A A G A P T P S Q P A Q S - D H D K I I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
pt000710_POPTR_    - - A A G A P T P S Q P A Q S - D H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
pt037730_POPTR_    - - - - - - - - - N V P V E - - E Q E K V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C
pt000712_POPTR_    - - A A G A P T P S Q P A Q S - D H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
pt001717_POPTR_    - - - - - - - - - N V P V E - - E Q E K V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C
pt041132_POPTR_    - - - - - - - - - N G P A G P - E H E N I I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A L C L S S F D T K I A C
pt034249_POPTR_    - - - - - - - - - N G P A G P - E H E N I I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C
pt000711_POPTR_    - - A A G A P T P S Q P A Q S - D H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
pt037558_POPTR_    - - - - - - - - - N V S S A - - D Q E R V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C
pt000709_POPTR_    - - A A G A P T P S Q P A Q S - D H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
pt025486_POPTR_    - - - - - - - - - S Q P G G R G D E D T V L L Q F G K V G E D T F T M D Y R L P L S A F Q A F A I C L T S F G T K L A C
pt001281_POPTR_    - - - - - - - - - N V P A A - - D Q E R V I L Q F G K I G K D I F T M D Y F Y P L S A F Q A F A I C L S S F D T K P A C
 
AT1G25280.1     E
pt028965_POPTR_    E
pt037559_POPTR_    E
pt039357_POPTR_    E
pt000710_POPTR_    E
pt037730_POPTR_    E
pt000712_POPTR_    E
pt001717_POPTR_    E
pt041132_POPTR_    E
pt034249_POPTR_    E
pt000711_POPTR_    E
pt037558_POPTR_    E
pt000709_POPTR_    E
pt025486_POPTR_    E
pt001281_POPTR_    E
 
0