fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G25280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os021774 not found in 445aa AT1G25280.1 1st_1st 0.684824902 Ia
Os021773 not found in 445aa AT1G25280.1 not_1st 0.684824902 II
Os029803 not found in 451aa AT1G25280.1 not_1st 0.682230869 II
Os019651 not found in 462aa AT1G25280.1 not_1st 0.662775616 II
Os019649 not found in 462aa AT1G25280.1 not_1st 0.662775616 II
Os040209 not found in 445aa AT1G25280.1 not_1st 0.648508430 II
Os004869 not found in 448aa AT1G25280.1 not_1st 0.626459143 II
Os009468 not found in 428aa AT2G18280.2 not_not 0.505836575 III
Os009471 not found in 416aa AT2G18280.2 not_not 0.505836575 III
Os029491 not found in 406aa AT2G47900.2 not_not 0.505836575 III
Os029490 not found in 406aa AT2G47900.2 not_not 0.505836575 III
Os037720 not found in 317aa AT1G25280.1 not_1st 0.430609597 II
Os022387 not found in 372aa AT1G53320.1 not_not 0.411154345 III
Os022386 not found in 372aa AT1G53320.1 not_not 0.411154345 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G25280.1     MSFRGIVQD---LRDGFGSLSRRSFDFRLSSL------HKGKAQGSSFREYSSSRDLLSP
Os029490_Os07t0 MSFRSVIQE---VKGEIGAISRRGFRSRPG---------RVRRVAAA---AEEPPD-ESS
Os029803_Os08t0 MSFRSIVRD---VRDSFGSLSRRSFEVRISGLPGLSGHHRGKSLGSL----SELRD--RP
Os037720_Os11t0 ------------------------------------------------------------
Os022386_Os05t0 MALWRCSSSW------LSSVSRSS-----------GGVGGGESKVSPEI---------AP
Os019651_Os04t0 MSFRSIVRD---FRDSFGTLSKRSFEVKIS---GFSGRHRGKSIGPS----SELDD--TP
Os004869_Os01t0 MSFRSIVRD---VRDGFGSLSRRSFEVTLASLYGLTGHHKGKTQSSL----DELDD--SP
Os022387_Os05t0 MALWRCSSSW------LSSVSRSS-----------GGVGGGESKVSPEI---------AP
Os019649_Os04t0 MSFRSIVRD---FRDSFGTLSKRSFEVKIS---GFSGRHRGKSIGPS----SELDD--TP
Os009471_Os02t0 ------------MRDGIGSMSRRAADGRAGG-------GRGGSRHSWPVLWSEQQQ--PP
Os029491_Os07t0 MSFRSVIQE---VKGEIGAISRRGFRSRPG---------RVRRVAAA---AEEPPD-ESS
Os040209_Os12t0 MSFRSIVRD---VRDGFGSLSRRGFEVRLV------GHRRGRSHSAV----HELRD--GH
Os009468_Os02t0 MSLKSIVRELREMRDGIGSMSRRAADGRAGG-------GRGGSRHSWPVLWSEQQQ--PP
Os021774_Os05t0 MSFRSIVRD---VRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTV----HELCD--AD
Os021773_Os05t0 MSFRSIVRD---VRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTV----HELCD--AD
                                                                            

AT1G25280.1     V----------IVQTSRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSWRAMC
Os029490_Os07t0 AAAL-------VMRESCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIV
Os029803_Os08t0 V----------VVDQSRWVGLPPELLRDVMKRLEEGESNWPSRKDVVACAAVCRTWREIC
Os037720_Os11t0 ------------------------------------------------------------
Os022386_Os05t0 VSGGEGEGEEEEGEEERWSRLLPELLTEIMRRVDAGAERWPPRRDVVACACVCRRWRDAA
Os019651_Os04t0 V----------VAQQSKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTWRDMC
Os004869_Os01t0 A----------IIPESRWASLPPELLREVIRRLEADESTWPSRRNVVCFAAVCRTWREMC
Os022387_Os05t0 VSGGEGEGEEEEGEEERWSRLLPELLTEIMRRVDAGAERWPPRRDVVACACVCRRWRDAA
Os019649_Os04t0 V----------VAQQSKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTWRDMC
Os009471_Os02t0 QQQQLQR-QEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVT
Os029491_Os07t0 AAAL-------VMRESCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIV
Os040209_Os12t0 AAAAAA----DVVQSSCWANLPPELLRDVIERLEASEAAWPSRKNVVACAAVCRTWRDMC
Os009468_Os02t0 QQQQLQR-QEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVT
Os021774_Os05t0 L----------IIQESRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMC
Os021773_Os05t0 L----------IIQESRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMC
                                                                            

AT1G25280.1     QEIVLGPEICGKLTFPVSLKQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVENGKFL
Os029490_Os07t0 REIVRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKFL
Os029803_Os08t0 KDIVQSPEICGKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPAVLSENGKFL
Os037720_Os11t0 ----------------------------MQCFIRRDKSTQTYYLYLSLGSAVLVDNGKFL
Os022386_Os05t0 VSVVRPPLECGRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQA-LTDKGKFL
Os019651_Os04t0 KDIVRNPEFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKFL
Os004869_Os01t0 KETVLSPEFCGKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNVVTAEGGKFV
Os022387_Os05t0 VSVVRPPLECGRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQA-LTDKGKFL
Os019649_Os04t0 KDIVRNPEFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKFL
Os009471_Os02t0 KEVVKTLEECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLL
Os029491_Os07t0 REIVRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKFL
Os040209_Os12t0 REIVKNPEFCGKITFPVSLKQPGPRNGAIQCFIKRDKSTQTYNLYLCLSSAVLVESGKFL
Os009468_Os02t0 KEVVKTLEECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLL
Os021774_Os05t0 KEIVLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFL
Os021773_Os05t0 KEIVLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFL
                                            ::*:: *:: . *: *:: *      : .*::

AT1G25280.1     LSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGTKFLVYDTQPPPNTSSSALI
Os029490_Os07t0 LAARKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPYAGDVISK-
Os029803_Os08t0 LAAKRNRRATSTEYIISVDSKNISRSSNGYVGKMRSNFLGTKFVVYDTQPPYNAGSLMS-
Os037720_Os11t0 LSAKRNWHATCTEYVISMNANNLSRSTNTNIGKLRSNFLGTKFVIYDTHTPYNATSDSQ-
Os022386_Os05t0 LAARRFRNGAHTEYIISYDCDDLFPGSNSYVGKLRSDFLGTKFIIYDSQPPYDGAKPSR-
Os019651_Os04t0 LSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCS-
Os004869_Os01t0 LAAKRHRKTTCTEYTISMVSGNISRSSRTNIGKLRSNFLGTKFIIYDTQPPYNGAVVPH-
Os022387_Os05t0 LAARRFRNGAHTEYIISYDCDDLFPGSNSYVGKLRSDFLGTKFIIYDSQPPYDGAKPSR-
Os019649_Os04t0 LSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCS-
Os009471_Os02t0 LAARKIRRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPN-
Os029491_Os07t0 LAARKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPYAGDVISK-
Os040209_Os12t0 LSAKRYSRATCTEYTIFMSADNTSRSSNMYIGKLRSNLLGTKFVIYDTQPPCNTANVSQ-
Os009468_Os02t0 LAARKIRRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPN-
Os021774_Os05t0 LSAKRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPP-
Os021773_Os05t0 LSAKRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPP-
                *:*::  . : *.: *     :    :   :**::.::***** ::*::..         

AT1G25280.1     TDRTSRSRFHSRRVSPKVPSGSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGS
Os029490_Os07t0 -GQSAR-VIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAIEQGGT
Os029803_Os08t0 CQHGSR-RISSRRVSPKLPTGSYPIAHVKYELNVLGTRGPRRMQCTMHSIPASAVDPEGV
Os037720_Os11t0 SGKTSR-RF-SNKGTAKHPCSTYSIANISYELNVFGTRGPRRMCCLMHSIPASSLEAGGT
Os022386_Os05t0 -SQSSR-RFASKQINPNVSGGNYEVGQVSYKFNFLKSRGPRRMQCNIQC-----------
Os019651_Os04t0 QERTSR-RFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAVEPGGI
Os004869_Os01t0 VGRTSK-RFNSTKVSPKVPSVTYNIAQVSYELNVLGTRGPRRMRCMMHSIPASSVEPGGI
Os022387_Os05t0 -SQSSR-RFASKQINPNVSGGNYEVGQVSYKFNFLKSRGPRRMQCNIQC-----------
Os019649_Os04t0 QERTSR-RFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAVEPGGI
Os009471_Os02t0 -NRPSKRHF--KQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCIQEGGK
Os029491_Os07t0 -GQSAR-VIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAIEQGGT
Os040209_Os12t0 SGKTSR-RFYSRKVSPKNPSSTYSIAQVSYELNVLGTRGPRRMNCVMHSIPASSLEAGGT
Os009468_Os02t0 -NRPSKRHF--KQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCIQEGGK
Os021774_Os05t0 VGRSSR-RFNSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSVEPGGI
Os021773_Os05t0 VGRSSR-RFNSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSVEPGGI
                  : ::  :   : ... .   * :  :.*::..: .****** * :..           

AT1G25280.1     VPNQPEKLVPAPYSLDD-SFRSN-ISFSKS---------SFDHRSL------DFSSSRFS
Os029490_Os07t0 APTQTE--FPL--SYHE-SFTSI--PFFKS-------------KSV------RANNSTAS
Os029803_Os08t0 VPGQPEQLLPG--PFEE-SFRSTNTS-SRF---------SFMDRSL------DFSSSRFS
Os037720_Os11t0 VPSQPDSILAH--SLNESSFRSV--SFSKS---------SVMDHSM------HFSSAQFS
Os022386_Os05t0 -------------PVGQ-STASD--PLKKL------------------------------
Os019651_Os04t0 VPGQPKELLPR--LFEE-SFRSMATSFSKY---------SITDHST------DFSSSRFS
Os004869_Os01t0 VPGQPEQIVPR--ALED-SFRST-TSFSQSFRSTTSFSKSIMDPSM------DFSSARFS
Os022387_Os05t0 -------------PVGQ-STASD--PLKKL------------------------------
Os019649_Os04t0 VPGQPKELLPR--LFEE-SFRSMATSFSKY---------SITDHST------DFSSSRFS
Os009471_Os02t0 APT-PTGII---HSLDE-QVPAL--STSKG-----------KEPAI------EFSSTSLS
Os029491_Os07t0 APTQTE--FPL--SYHE-SFTSI--PFFKS-------------KSV------RANNSTAS
Os040209_Os12t0 VPCQPDSVLAR--SLDE-SFGSI--SFSKS---------SIMDRSI------RFSSSRYS
Os009468_Os02t0 APT-PTGII---HSLDE-QVPAL--STSKG-----------KEPAI------EFSSTSLS
Os021774_Os05t0 VPGQPEQIVPR--AFEE-SFRST-TSFSKS---------SIMDRSMDFSSSRDFSSARFS
Os021773_Os05t0 VPGQPEQIVPR--AFEE-SFRST-TSFSKS---------SIMDRSMDFSSSRDFSSARFS
                                : .  :   .  :                               

AT1G25280.1     -EMGI------------SCDDNEEEASFRPLILKNKQPRWHEQLQCWCLNFRGRVTVASV
Os029490_Os07t0 -LLTQN-GSK--------------------LVLKNKSPRWHEHLQCWCLNFHGRVTVASV
Os029803_Os08t0 -EIS---GSANQ-----QGEDDIPEAKERPLVLRNKVPRWHEQLQCWCLNFRGRVTVASV
Os037720_Os11t0 -DISIGDGPRIGGR---VLSDDE-ECKETPLILQNKAPRWHEQLQCWCLNFRGRVTVASV
Os022386_Os05t0 ------------------------ISTSSPLALRNKAPRWHEHLQCWCLNFHGRVTVASV
Os019651_Os04t0 -EFG---GGALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASV
Os004869_Os01t0 -DIS---GSI-------MGGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIASV
Os022387_Os05t0 ------------------------ISTSSPLALRNKAPRWHEHLQCWCLNFHGRVTVASV
Os019649_Os04t0 -EFG---GGALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASV
Os009471_Os02t0 ADLS---GPV--------------CTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASV
Os029491_Os07t0 -LLTQN-GSK--------------------LVLKNKSPRWHEHLQCWCLNFHGRVTVASV
Os040209_Os12t0 -DISVG-GPMVGGQ---ALGDSD-ESKERPLILRNKAPRWHEQLQCWCLNFKGRVTVASV
Os009468_Os02t0 ADLS---GPV--------------CTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASV
Os021774_Os05t0 -DIA---GGT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASV
Os021773_Os05t0 -DIA---GGT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASV
                                              * *:** *****:********:****:***

AT1G25280.1     KNFQLVAAR-QPQPQGTGAAAAPT--SAPAHPEQ-------------------DKVILQF
Os029490_Os07t0 KNFQLVASD----------------ESNPTNQEH-------------------DDVILQF
Os029803_Os08t0 KNFQLIAAA----------------SSESSQLEQQQQQQQQNHASSSSSASDHGKVILQF
Os037720_Os11t0 KNFQLIAAT-QP------AAGAPT-PSQPVPPPP----------------PEHDKVILQF
Os022386_Os05t0 KNFQLVAPA------G---------TSDP------------------WGIADEETVILQF
Os019651_Os04t0 KNFQLIAAAPQP------SSGAASEPSQAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQF
Os004869_Os01t0 KNFQLVAAPSPP------PAGAPT-PSQPGPADP-------------------EKVILQF
Os022387_Os05t0 KNFQLVAPA------G---------TSDP------------------WGIADEETVILQF
Os019649_Os04t0 KNFQLIAAAPQP------SSGAASEPSQAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQF
Os009471_Os02t0 KNFQLVASV-DP------SLGIPA-------AEQ-------------------EKVILQF
Os029491_Os07t0 KNFQLVASD----------------ESNPTNQEH-------------------DDVILQF
Os040209_Os12t0 KNFQLVAAT-QP------AAGAPT-PSQPAPPPP----------------PDHDKVILQF
Os009468_Os02t0 KNFQLVASV-DP------SLGIPA-------AEQ-------------------EKVILQF
Os021774_Os05t0 KNFQLIAAPAQP------PAGAPT-PSQPAPPEQ-------------------DKIILQF
Os021773_Os05t0 KNFQLIAAPAQP------PAGAPT-PSQPAPPEQ-------------------DKIILQF
                *****:*.                                               :****

AT1G25280.1     GKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os029490_Os07t0 GKVGKDMFTMDYRYPISAFQAFAICLSSFDTKIACE
Os029803_Os08t0 GKVGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
Os037720_Os11t0 GKVAKDMFTMDYHYPLSAFQAFAISLSSFDTKLACE
Os022386_Os05t0 GKIEDDAFTMDYRQPLSAFQAFAICLTSFGTKLACE
Os019651_Os04t0 GKVAKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
Os004869_Os01t0 GKVARDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os022387_Os05t0 GKIEDDAFTMDYRQPLSAFQAFAICLTSFGTKLACE
Os019649_Os04t0 GKVAKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
Os009471_Os02t0 GKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE
Os029491_Os07t0 GKVGKDMFTMDYRYPISAFQAFAICLSSFDTKIACE
Os040209_Os12t0 GKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os009468_Os02t0 GKIGKDIFTMDYRYPLSAFQAFAICLTSFDTKPACE
Os021774_Os05t0 GKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os021773_Os05t0 GKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
                **:  * *****: *:********.*:**.** ***


BoxShade v3.31 C (beta, 970507) Output
AT1G25280.1     M S F R G I V Q D - - - L R D G F G S L S R R S F D F R L S S L - - - - - - H K G K A Q G S S F R E Y S S S R D L L S P
Os029490_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F R S R P G - - - - - - - - - R V R R V A A A - - - A E E P P D - E S S
Os029803_Os08t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V R I S G L P G L S G H H R G K S L G S L - - - - S E L R D - - R P
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022386_Os05t0    M A L W R C S S S W - - - - - - L S S V S R S S - - - - - - - - - - - G G V G G G E S K V S P E I - - - - - - - - - A P
Os019651_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F E V K I S - - - G F S G R H R G K S I G P S - - - - S E L D D - - T P
Os004869_Os01t0    M S F R S I V R D - - - V R D G F G S L S R R S F E V T L A S L Y G L T G H H K G K T Q S S L - - - - D E L D D - - S P
Os022387_Os05t0    M A L W R C S S S W - - - - - - L S S V S R S S - - - - - - - - - - - G G V G G G E S K V S P E I - - - - - - - - - A P
Os019649_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F E V K I S - - - G F S G R H R G K S I G P S - - - - S E L D D - - T P
Os009471_Os02t0    - - - - - - - - - - - - M R D G I G S M S R R A A D G R A G G - - - - - - - G R G G S R H S W P V L W S E Q Q Q - - P P
Os029491_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F R S R P G - - - - - - - - - R V R R V A A A - - - A E E P P D - E S S
Os040209_Os12t0    M S F R S I V R D - - - V R D G F G S L S R R G F E V R L V - - - - - - G H R R G R S H S A V - - - - H E L R D - - G H
Os009468_Os02t0    M S L K S I V R E L R E M R D G I G S M S R R A A D G R A G G - - - - - - - G R G G S R H S W P V L W S E Q Q Q - - P P
Os021774_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V - - - - H E L C D - - A D
Os021773_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V - - - - H E L C D - - A D
 
AT1G25280.1     V - - - - - - - - - - I V Q T S R W A N L P P E L L F D V I K R L E E S E S N W P A R K H V V A C A S V C R S W R A M C
Os029490_Os07t0    A A A L - - - - - - - V M R E S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W R G I V
Os029803_Os08t0    V - - - - - - - - - - V V D Q S R W V G L P P E L L R D V M K R L E E G E S N W P S R K D V V A C A A V C R T W R E I C
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022386_Os05t0    V S G G E G E G E E E E G E E E R W S R L L P E L L T E I M R R V D A G A E R W P P R R D V V A C A C V C R R W R D A A
Os019651_Os04t0    V - - - - - - - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W R D M C
Os004869_Os01t0    A - - - - - - - - - - I I P E S R W A S L P P E L L R E V I R R L E A D E S T W P S R R N V V C F A A V C R T W R E M C
Os022387_Os05t0    V S G G E G E G E E E E G E E E R W S R L L P E L L T E I M R R V D A G A E R W P P R R D V V A C A C V C R R W R D A A
Os019649_Os04t0    V - - - - - - - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W R D M C
Os009471_Os02t0    Q Q Q Q L Q R - Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T
Os029491_Os07t0    A A A L - - - - - - - V M R E S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W R G I V
Os040209_Os12t0    A A A A A A - - - - D V V Q S S C W A N L P P E L L R D V I E R L E A S E A A W P S R K N V V A C A A V C R T W R D M C
Os009468_Os02t0    Q Q Q Q L Q R - Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T
Os021774_Os05t0    L - - - - - - - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C
Os021773_Os05t0    L - - - - - - - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C
 
AT1G25280.1     Q E I V L G P E I C G K L T F P V S L K Q P G P R D A M I Q C F I K R D K S K L T F H L F L C L S P A L L V E N G K F L
Os029490_Os07t0    R E I V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F L
Os029803_Os08t0    K D I V Q S P E I C G K L T F P V S L K Q P G P R D G L I Q C F I K R D K S K L T Y Y L Y L C L S P A V L S E N G K F L
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - M Q C F I R R D K S T Q T Y Y L Y L S L G S A V L V D N G K F L
Os022386_Os05t0    V S V V R P P L E C G R I T F P S S L K Q P G P R D A P M H C F I R R N K K N S T F Y L Y L S L T Q A - L T D K G K F L
Os019651_Os04t0    K D I V R N P E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F L
Os004869_Os01t0    K E T V L S P E F C G K L T F P V S I K Q P G P R D G M I Q C Y I K R N R S K S T Y H L Y L C L S N V V T A E G G K F V
Os022387_Os05t0    V S V V R P P L E C G R I T F P S S L K Q P G P R D A P M H C F I R R N K K N S T F Y L Y L S L T Q A - L T D K G K F L
Os019649_Os04t0    K D I V R N P E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F L
Os009471_Os02t0    K E V V K T L E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L L
Os029491_Os07t0    R E I V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F L
Os040209_Os12t0    R E I V K N P E F C G K I T F P V S L K Q P G P R N G A I Q C F I K R D K S T Q T Y N L Y L C L S S A V L V E S G K F L
Os009468_Os02t0    K E V V K T L E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L L
Os021774_Os05t0    K E I V L S P E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F L
Os021773_Os05t0    K E I V L S P E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F L
 
AT1G25280.1     L S A K R T R R T T R T E Y I I S M D A D N I S R S S N S Y L G K L R S N F L G T K F L V Y D T Q P P P N T S S S A L I
Os029490_Os07t0    L A A R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y A G D V I S K -
Os029803_Os08t0    L A A K R N R R A T S T E Y I I S V D S K N I S R S S N G Y V G K M R S N F L G T K F V V Y D T Q P P Y N A G S L M S -
Os037720_Os11t0    L S A K R N W H A T C T E Y V I S M N A N N L S R S T N T N I G K L R S N F L G T K F V I Y D T H T P Y N A T S D S Q -
Os022386_Os05t0    L A A R R F R N G A H T E Y I I S Y D C D D L F P G S N S Y V G K L R S D F L G T K F I I Y D S Q P P Y D G A K P S R -
Os019651_Os04t0    L S A K R S R R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S -
Os004869_Os01t0    L A A K R H R K T T C T E Y T I S M V S G N I S R S S R T N I G K L R S N F L G T K F I I Y D T Q P P Y N G A V V P H -
Os022387_Os05t0    L A A R R F R N G A H T E Y I I S Y D C D D L F P G S N S Y V G K L R S D F L G T K F I I Y D S Q P P Y D G A K P S R -
Os019649_Os04t0    L S A K R S R R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S -
Os009471_Os02t0    L A A R K I R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N -
Os029491_Os07t0    L A A R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y A G D V I S K -
Os040209_Os12t0    L S A K R Y S R A T C T E Y T I F M S A D N T S R S S N M Y I G K L R S N L L G T K F V I Y D T Q P P C N T A N V S Q -
Os009468_Os02t0    L A A R K I R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N -
Os021774_Os05t0    L S A K R H R K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P -
Os021773_Os05t0    L S A K R H R K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P -
 
AT1G25280.1     T D R T S R S R F H S R R V S P K V P S G S Y N I A Q I T Y E L N V L G T R G P R R M H C I M N S I P I S S L E P G G S
Os029490_Os07t0    - G Q S A R - V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I E Q G G T
Os029803_Os08t0    C Q H G S R - R I S S R R V S P K L P T G S Y P I A H V K Y E L N V L G T R G P R R M Q C T M H S I P A S A V D P E G V
Os037720_Os11t0    S G K T S R - R F - S N K G T A K H P C S T Y S I A N I S Y E L N V F G T R G P R R M C C L M H S I P A S S L E A G G T
Os022386_Os05t0    - S Q S S R - R F A S K Q I N P N V S G G N Y E V G Q V S Y K F N F L K S R G P R R M Q C N I Q C - - - - - - - - - - -
Os019651_Os04t0    Q E R T S R - R F S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V E P G G I
Os004869_Os01t0    V G R T S K - R F N S T K V S P K V P S V T Y N I A Q V S Y E L N V L G T R G P R R M R C M M H S I P A S S V E P G G I
Os022387_Os05t0    - S Q S S R - R F A S K Q I N P N V S G G N Y E V G Q V S Y K F N F L K S R G P R R M Q C N I Q C - - - - - - - - - - -
Os019649_Os04t0    Q E R T S R - R F S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V E P G G I
Os009471_Os02t0    - N R P S K R H F - - K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I Q E G G K
Os029491_Os07t0    - G Q S A R - V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I E Q G G T
Os040209_Os12t0    S G K T S R - R F Y S R K V S P K N P S S T Y S I A Q V S Y E L N V L G T R G P R R M N C V M H S I P A S S L E A G G T
Os009468_Os02t0    - N R P S K R H F - - K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I Q E G G K
Os021774_Os05t0    V G R S S R - R F N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V E P G G I
Os021773_Os05t0    V G R S S R - R F N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V E P G G I
 
AT1G25280.1     V P N Q P E K L V P A P Y S L D D - S F R S N - I S F S K S - - - - - - - - - S F D H R S L - - - - - - D F S S S R F S
Os029490_Os07t0    A P T Q T E - - F P L - - S Y H E - S F T S I - - P F F K S - - - - - - - - - - - - - K S V - - - - - - R A N N S T A S
Os029803_Os08t0    V P G Q P E Q L L P G - - P F E E - S F R S T N T S - S R F - - - - - - - - - S F M D R S L - - - - - - D F S S S R F S
Os037720_Os11t0    V P S Q P D S I L A H - - S L N E S S F R S V - - S F S K S - - - - - - - - - S V M D H S M - - - - - - H F S S A Q F S
Os022386_Os05t0    - - - - - - - - - - - - - P V G Q - S T A S D - - P L K K L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    V P G Q P K E L L P R - - L F E E - S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S R F S
Os004869_Os01t0    V P G Q P E Q I V P R - - A L E D - S F R S T - T S F S Q S F R S T T S F S K S I M D P S M - - - - - - D F S S A R F S
Os022387_Os05t0    - - - - - - - - - - - - - P V G Q - S T A S D - - P L K K L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019649_Os04t0    V P G Q P K E L L P R - - L F E E - S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S R F S
Os009471_Os02t0    A P T - P T G I I - - - H S L D E - Q V P A L - - S T S K G - - - - - - - - - - - K E P A I - - - - - - E F S S T S L S
Os029491_Os07t0    A P T Q T E - - F P L - - S Y H E - S F T S I - - P F F K S - - - - - - - - - - - - - K S V - - - - - - R A N N S T A S
Os040209_Os12t0    V P C Q P D S V L A R - - S L D E - S F G S I - - S F S K S - - - - - - - - - S I M D R S I - - - - - - R F S S S R Y S
Os009468_Os02t0    A P T - P T G I I - - - H S L D E - Q V P A L - - S T S K G - - - - - - - - - - - K E P A I - - - - - - E F S S T S L S
Os021774_Os05t0    V P G Q P E Q I V P R - - A F E E - S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A R F S
Os021773_Os05t0    V P G Q P E Q I V P R - - A F E E - S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A R F S
 
AT1G25280.1     - E M G I - - - - - - - - - - - - S C D D N E E E A S F R P L I L K N K Q P R W H E Q L Q C W C L N F R G R V T V A S V
Os029490_Os07t0    - L L T Q N - G S K - - - - - - - - - - - - - - - - - - - - L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V
Os029803_Os08t0    - E I S - - - G S A N Q - - - - - Q G E D D I P E A K E R P L V L R N K V P R W H E Q L Q C W C L N F R G R V T V A S V
Os037720_Os11t0    - D I S I G D G P R I G G R - - - V L S D D E - E C K E T P L I L Q N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os022386_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - I S T S S P L A L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
Os019651_Os04t0    - E F G - - - G G A L Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os004869_Os01t0    - D I S - - - G S I - - - - - - - M G G D D N G E I K E R P L V L R N K P P R W H E Q L Q C W C L N F R G R V T I A S V
Os022387_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - I S T S S P L A L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
Os019649_Os04t0    - E F G - - - G G A L Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os009471_Os02t0    A D L S - - - G P V - - - - - - - - - - - - - - C T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os029491_Os07t0    - L L T Q N - G S K - - - - - - - - - - - - - - - - - - - - L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V
Os040209_Os12t0    - D I S V G - G P M V G G Q - - - A L G D S D - E S K E R P L I L R N K A P R W H E Q L Q C W C L N F K G R V T V A S V
Os009468_Os02t0    A D L S - - - G P V - - - - - - - - - - - - - - C T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os021774_Os05t0    - D I A - - - G G T - - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V
Os021773_Os05t0    - D I A - - - G G T - - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V
 
AT1G25280.1     K N F Q L V A A R - Q P Q P Q G T G A A A A P T - - S A P A H P E Q - - - - - - - - - - - - - - - - - - - D K V I L Q F
Os029490_Os07t0    K N F Q L V A S D - - - - - - - - - - - - - - - - E S N P T N Q E H - - - - - - - - - - - - - - - - - - - D D V I L Q F
Os029803_Os08t0    K N F Q L I A A A - - - - - - - - - - - - - - - - S S E S S Q L E Q Q Q Q Q Q Q Q N H A S S S S S A S D H G K V I L Q F
Os037720_Os11t0    K N F Q L I A A T - Q P - - - - - - A A G A P T - P S Q P V P P P P - - - - - - - - - - - - - - - - P E H D K V I L Q F
Os022386_Os05t0    K N F Q L V A P A - - - - - - G - - - - - - - - - T S D P - - - - - - - - - - - - - - - - - - W G I A D E E T V I L Q F
Os019651_Os04t0    K N F Q L I A A A P Q P - - - - - - S S G A A S E P S Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F
Os004869_Os01t0    K N F Q L V A A P S P P - - - - - - P A G A P T - P S Q P G P A D P - - - - - - - - - - - - - - - - - - - E K V I L Q F
Os022387_Os05t0    K N F Q L V A P A - - - - - - G - - - - - - - - - T S D P - - - - - - - - - - - - - - - - - - W G I A D E E T V I L Q F
Os019649_Os04t0    K N F Q L I A A A P Q P - - - - - - S S G A A S E P S Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F
Os009471_Os02t0    K N F Q L V A S V - D P - - - - - - S L G I P A - - - - - - - A E Q - - - - - - - - - - - - - - - - - - - E K V I L Q F
Os029491_Os07t0    K N F Q L V A S D - - - - - - - - - - - - - - - - E S N P T N Q E H - - - - - - - - - - - - - - - - - - - D D V I L Q F
Os040209_Os12t0    K N F Q L V A A T - Q P - - - - - - A A G A P T - P S Q P A P P P P - - - - - - - - - - - - - - - - P D H D K V I L Q F
Os009468_Os02t0    K N F Q L V A S V - D P - - - - - - S L G I P A - - - - - - - A E Q - - - - - - - - - - - - - - - - - - - E K V I L Q F
Os021774_Os05t0    K N F Q L I A A P A Q P - - - - - - P A G A P T - P S Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F
Os021773_Os05t0    K N F Q L I A A P A Q P - - - - - - P A G A P T - P S Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F
 
AT1G25280.1     G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os029490_Os07t0    G K V G K D M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
Os029803_Os08t0    G K V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os037720_Os11t0    G K V A K D M F T M D Y H Y P L S A F Q A F A I S L S S F D T K L A C E
Os022386_Os05t0    G K I E D D A F T M D Y R Q P L S A F Q A F A I C L T S F G T K L A C E
Os019651_Os04t0    G K V A K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os004869_Os01t0    G K V A R D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os022387_Os05t0    G K I E D D A F T M D Y R Q P L S A F Q A F A I C L T S F G T K L A C E
Os019649_Os04t0    G K V A K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os009471_Os02t0    G K I G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K P A C E
Os029491_Os07t0    G K V G K D M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
Os040209_Os12t0    G K V A K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os009468_Os02t0    G K I G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K P A C E
Os021774_Os05t0    G K V A K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os021773_Os05t0    G K V A K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
 
0