fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G25280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Gm041219 not found in 427aa AT1G25280.1 1st_1st 0.741893644 Ia
Gm021743 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm021742 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm021741 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm021740 not found in 427aa AT1G25280.1 not_1st 0.728923476 II
Gm003397 not found in 424aa AT1G25280.1 not_1st 0.696498054 II
Gm003395 not found in 424aa AT1G25280.1 not_1st 0.696498054 II
Gm044960 not found in 424aa AT1G25280.1 not_1st 0.693904020 II
Gm044959 not found in 424aa AT1G25280.1 not_1st 0.693904020 II
Gm054929 not found in 430aa AT1G25280.1 not_1st 0.691309987 II
Gm054928 not found in 430aa AT1G25280.1 not_1st 0.691309987 II
Gm028527 not found in 430aa AT1G25280.1 not_1st 0.683527885 II
Gm028526 not found in 430aa AT1G25280.1 not_1st 0.683527885 II
Gm003396 not found in 407aa AT1G25280.1 not_1st 0.609597924 II
Gm030081 not found in 414aa AT2G18280.2 not_not 0.527885862 III
Gm030080 not found in 414aa AT2G18280.2 not_not 0.527885862 III
Gm001764 not found in 415aa AT2G18280.2 not_not 0.522697795 III
Gm036751 not found in 389aa AT2G47900.2 not_not 0.517509727 III
Gm041730 not found in 385aa AT2G47900.2 not_not 0.514915693 III
Gm003133 not found in 414aa AT2G18280.2 not_not 0.514915693 III
Gm004126 not found in 400aa AT2G47900.2 not_not 0.511024643 III
Gm039266 not found in 423aa AT1G47270.1 not_not 0.503242542 III
Gm039265 not found in 423aa AT1G47270.1 not_not 0.503242542 III
Gm044675 not found in 414aa AT2G18280.2 not_not 0.501945525 III
Gm019438 not found in 359aa AT2G47900.2 not_not 0.485084306 III
Gm045746 not found in 362aa AT2G47900.2 not_not 0.477302204 III
Gm045745 not found in 362aa AT2G47900.2 not_not 0.477302204 III
Gm045744 not found in 392aa AT2G47900.2 not_not 0.456549935 III
Gm048089 not found in 410aa AT1G47270.1 not_not 0.428015564 III
Gm037352 not found in 381aa AT1G53320.1 not_not 0.424124513 III
Gm034540 not found in 378aa AT1G53320.1 not_not 0.422827496 III
Gm036752 not found in 290aa AT2G47900.2 not_not 0.411154345 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G25280.1     MSFRGIVQDLR---DGFGSLSRRSFDFRLSSLHKGKAQG----SSFREYSSSRD--LLSP
gm003397_Glyma0 MSFRSIVRDVR---DGFGSLSRRSFDVRISGG--GKLNS----LVHEAHE--------RQ
gm036752_Glyma1 ------------------------------------------------------------
gm003396_Glyma0 MSFRSIVRDVR---DGFGSLSRRSFDVRISGG--GKLNS----LVHEAHE--------RQ
gm021740_Glyma0 MSFRSIVRDVR---DSFGSLSRRSFDVRLTGHHRGKSQG----SVQDLHD--------QP
gm034540_Glyma1 MSLRKVFRSRK--------FSKSFKEVL---PAEGAAV---EGGVAGTVEEAANG-----
gm045744_Glyma1 --------------------------------------------MIEVQ----------A
gm039266_Glyma1 MPFRSIVRELKEIGEGISNMYRRGGEAK---HVHRHGKS----HIAPECS------LPPP
gm036751_Glyma1 -----MG------------LIR---------SMRSRSQ-----RVVQEQEAAECVGVVVG
gm044959_Glyma1 MSFRSIVRDVR---DGFGSLSRRSFDVRLSGG--GKSNS----LVHEEHE--------CL
gm030081_Glyma1 MSLKSIVRELKEMRDGIGSMSRRGVESR---RWNGRTKS----HVAPDVT------LTSL
gm028526_Glyma1 MSFRSIVREVR---DGFGSLSRRSFEVRLPGHNRGKSRS----LVHELQD--------QP
gm045746_Glyma1 --------------------------------------------MIEVQ----------A
gm028527_Glyma1 MSFRSIVREVR---DGFGSLSRRSFEVRLPGHNRGKSRS----LVHELQD--------QP
gm054928_Glyma2 MSFRSIVRDVR---DGFGSLSRRSFEVRLPGHNRGKSRS----SVHELQD--------QP
gm003395_Glyma0 MSFRSIVRDVR---DGFGSLSRRSFDVRISGG--GKLNS----LVHEAHE--------RQ
gm044960_Glyma1 MSFRSIVRDVR---DGFGSLSRRSFDVRLSGG--GKSNS----LVHEEHE--------CL
gm003133_Glyma0 MSLRSIVRELKEMRDGIGSTSKRGAESK---HRLSRTKS----HVAPDVL------ATPF
gm004126_Glyma0 MSFRSII------------LERKGFEVKFGYSMRSRSQSH-SDAIAQDS-------LVVL
gm021741_Glyma0 MSFRSIVRDVR---DSFGSLSRRSFDVRLTGHHRGKSQG----SVQDLHD--------QP
gm048089_Glyma1 MPFRSIVRELKEIGEGISNMYRRGGEAK---HVHRHGKS----HIAPECS------LPPP
gm037352_Glyma1 MSLRKVFRSRK--------FSRSFKEVL---PAEGAAIVGGEDGVAGAGEESSNG-----
gm039265_Glyma1 MPFRSIVRELKEIGEGISNMYRRGGEAK---HVHRHGKS----HIAPECS------LPPP
gm044675_Glyma1 MSLRSIVRELKEMRDGIGSTSKRGAESK---HWLSRTKS----HVAPDIL------ATPF
gm041730_Glyma1 -----MC------------LIR---------SMRSQSQ-----RVVQEQEEAEC----VG
gm021742_Glyma0 MSFRSIVRDVR---DSFGSLSRRSFDVRLTGHHRGKSQG----SVQDLHD--------QP
gm001764_Glyma0 MSLKSIVRELKEMRDGIGSMSRRGVESR---RWNGRTKS----HVAPDVI------LTSL
gm054929_Glyma2 MSFRSIVRDVR---DGFGSLSRRSFEVRLPGHNRGKSRS----SVHELQD--------QP
gm045745_Glyma1 --------------------------------------------MIEVQ----------A
gm019438_Glyma0 ------------------------------------------------------------
gm041219_Glyma1 MSFRSIVRDVR---DSFGSLSRRSFDVRLTGHHRGKSQG----SVQDLHD--------QP
gm021743_Glyma0 MSFRSIVRDVR---DSFGSLSRRSFDVRLTGHHRGKSQG----SVQDLHD--------QP
gm030080_Glyma1 MSLKSIVRELKEMRDGIGSMSRRGVESR---RWNGRTKS----HVAPDVT------LTSL
                                                                            

AT1G25280.1     VIVQ---------TSRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSW-RAMC
gm003397_Glyma0 LVIQ---------NSRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REMC
gm036752_Glyma1 ------------------------------------------------------------
gm003396_Glyma0 LVIQ---------NSRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REMC
gm021740_Glyma0 LVIQ---------NSRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMC
gm034540_Glyma1 ------------NNNGWSSMLPEILGEIVRRVDAAEEQWPNRQNVVACACVCKRW-RDIT
gm045744_Glyma1 NAME---------QSWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLIV
gm039266_Glyma1 PPPPPSSSS----QSRWANLPPELLLDIIQRLEASETSWPARRALVACASVCRLW-REIT
gm036751_Glyma1 DSMR---------QSCWANMPQELLREVLLRIEASEDTWPPRKSVVSCAGVCRSW-RHIT
gm044959_Glyma1 PVVQ---------NSRWASLPPELLRDVIKRLEESETTWPARKHVVACAAVCRSW-RGMC
gm030081_Glyma1 EPIQ---------QGHWANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAVT
gm028526_Glyma1 PVIQ---------NSRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMC
gm045746_Glyma1 NAME---------QSWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLIV
gm028527_Glyma1 PVIQ---------NSRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMC
gm054928_Glyma2 PVIQ---------NSRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMC
gm003395_Glyma0 LVIQ---------NSRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REMC
gm044960_Glyma1 PVVQ---------NSRWASLPPELLRDVIKRLEESETTWPARKHVVACAAVCRSW-RGMC
gm003133_Glyma0 EPIQ---------QGQWANLPSELLLDIIQRVEESETSWPARAVVVFCASVCKSW-RSIT
gm004126_Glyma0 DGLK---------QSCWANMPPELLRDVLMRIEASEDSWPAQKHVVACAGVCRSW-REIM
gm021741_Glyma0 LVIQ---------NSRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMC
gm048089_Glyma1 PSSSSSSSSSSSWQSRWANLPPELLLDIIQRLEASETSWPARRALVACASVCKLW-REIT
gm037352_Glyma1 -------------NNGWSNMLPEILGEIVRRVDAAEEQWPNRQNVVACACVCKRW-RDIT
gm039265_Glyma1 PPPPPSSSS----QSRWANLPPELLLDIIQRLEASETSWPARRALVACASVCRLW-REIT
gm044675_Glyma1 EPIQ---------QGQWANLPSELLLDIIQRIEESETSWPARAVVVFCASVCKSW-RSIT
gm041730_Glyma1 DSMR---------QSCWANMPQELLREVLFRIEASEDAWPPRKSVVACAGVCRSW-RQIT
gm021742_Glyma0 LVIQ---------NSRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMC
gm001764_Glyma0 EPIQ---------QGQWANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAVT
gm054929_Glyma2 PVIQ---------NSRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REMC
gm045745_Glyma1 NAME---------QSWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLIV
gm019438_Glyma0 --ME---------QSWRANMPRELLREVLLRIESSEATWPSRRSVVACGGVCRTW-RLIV
gm041219_Glyma1 LVIQ---------NSRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMC
gm021743_Glyma0 LVIQ---------NSRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNMC
gm030080_Glyma1 EPIQ---------QGHWANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAVT
                                                                            

AT1G25280.1     QEIVLGPEICGKLTFPVSLKQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVENGKFL
gm003397_Glyma0 KEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm036752_Glyma1 --------------------MPGPRENLLRCFIKRNRSTQTYYLFLSLTSTL-AEDGKFL
gm003396_Glyma0 KEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm021740_Glyma0 KDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm034540_Glyma1 REVVRVPSHTGKITFPSCLKQPGPRDVPHQCLIKRNQKTSTFYLYLALTPSF-TDKGKFL
gm045744_Glyma1 KEIVKPPQFSSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSALVADDGKFL
gm039266_Glyma1 KDVIKTPEQCGLLTFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPALSGDMSKLL
gm036751_Glyma1 KDIVKTPELSSKITFPISVKQPGPRENLLRCFIKRNRSTQTYYLFLSLTSTL-AEDGKFL
gm044959_Glyma1 KEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm030081_Glyma1 KEIVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-ENETDKLL
gm028526_Glyma1 KEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLGLSPALLVENGKFL
gm045746_Glyma1 KEIVKPPQFSSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSALVADDGKFL
gm028527_Glyma1 KEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLGLSPALLVENGKFL
gm054928_Glyma2 KEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPALLVENGKFL
gm003395_Glyma0 KEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm044960_Glyma1 KEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm003133_Glyma0 REIVKTPEQCGRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLYFGLVPS-ENDSNKLL
gm004126_Glyma0 KEIVKSPQLSGKLTFPISLKQPGPRDSLLQCYIKRNRSNQTYYLFLGLNQAS-TDEGKFL
gm021741_Glyma0 KDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm048089_Glyma1 KDVVKTPEQCGFITFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPALSGDMSKLL
gm037352_Glyma1 REVVRVPSHTGKITFPACLKQPGPRDVPHQCLIKRNKKTSTFYLYLALTPSF-TDKGKFL
gm039265_Glyma1 KDVIKTPEQCGLLTFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPALSGDMSKLL
gm044675_Glyma1 REIVKTPEQCGRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLYFGLVPS-ENDGNKLL
gm041730_Glyma1 IDIVKTPELSSKITFPISVKQPGPRENLLRCFIKRNRSSQTYYLYLSLTNTL-AEDGKFL
gm021742_Glyma0 KDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm001764_Glyma0 KEIVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-ENETDKLL
gm054929_Glyma2 KEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPALLVENGKFL
gm045745_Glyma1 KEIVKPPQFSSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSALVADDGKFL
gm019438_Glyma0 KEIVKPPQLSSNITFPISLKQPGPREHLLQCFIRRNSATQTYYLFLSLSSALIADDGKFL
gm041219_Glyma1 KDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm021743_Glyma0 KDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFL
gm030080_Glyma1 KEIVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-ENETDKLL
                                     ** *:   :* *:*:  . *: *:: *  :   : .*:*

AT1G25280.1     LSAKRTRRTTRTEYIISMDADNISRSSNSYLGKL--------------------------
gm003397_Glyma0 LSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL--------------------------
gm036752_Glyma1 LAARKCRRPTCTDYIISLDADDMSKGSNSYVGKL--------------------------
gm003396_Glyma0 LSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL--------------------------
gm021740_Glyma0 LSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL--------------------------
gm034540_Glyma1 LAARRYRCGTHTEYIISLDADDLSQGSNAYVGKL--------------------------
gm045744_Glyma1 LAARKFRRPTCTDYIISLDADDMSRESNAYVGKLRSTLNQILLLAILLFLFLSAKTNPLS
gm039266_Glyma1 LAAKKIRRATCTEFIISLVADDFSRACDTYVGKL--------------------------
gm036751_Glyma1 LAARKCRRPTCTDYIISLDADDMSKGSNSYVGKL--------------------------
gm044959_Glyma1 LSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL--------------------------
gm030081_Glyma1 LAAKKVRRATGTDFIISLVADDFSRSSNTYVGKL--------------------------
gm028526_Glyma1 LSAKRTRRTTCTEYVISMDADNISRSSSTYIGKL--------------------------
gm045746_Glyma1 LAARKFRRPTCTDYIISLDADDMSRESNAYVGKL--------------------------
gm028527_Glyma1 LSAKRTRRTTCTEYVISMDADNISRSSSTYIGKL--------------------------
gm054928_Glyma2 LSAKRTRRTTCTEYIISMDADNISRSSSTYIGKL--------------------------
gm003395_Glyma0 LSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL--------------------------
gm044960_Glyma1 LSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL--------------------------
gm003133_Glyma0 LAAKRIRRATGTGFVISLAADDFSRASNKYVGKL--------------------------
gm004126_Glyma0 LSARKCRRATHTDYIISLNCDDVSRGSSTYIGKL--------------------------
gm021741_Glyma0 LSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL--------------------------
gm048089_Glyma1 LAAKKIRRATCTEFIISLVSDDFSWASNTYVGKL--------------------------
gm037352_Glyma1 LAARRYRCGTHTEYIISLDADDLSQGSNAYVGKL--------------------------
gm039265_Glyma1 LAAKKIRRATCTEFIISLVADDFSRACDTYVGKL--------------------------
gm044675_Glyma1 LAAKRIRRATGTDFIISLAADDFSRASNKYVGKL--------------------------
gm041730_Glyma1 LAARKCRRPTCTDYIISLDADDMSKGSNSYVGKL--------------------------
gm021742_Glyma0 LSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL--------------------------
gm001764_Glyma0 LAAKKVRRATGTDFVISLVADDFFRSSNTYVGKL--------------------------
gm054929_Glyma2 LSAKRTRRTTCTEYIISMDADNISRSSSTYIGKL--------------------------
gm045745_Glyma1 LAARKFRRPTCTDYIISLDADDMSRESNAYVGKL--------------------------
gm019438_Glyma0 LAARKFRRPTCIDYIISLDADDMSRESNAYVGKL--------------------------
gm041219_Glyma1 LSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL--------------------------
gm021743_Glyma0 LSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL--------------------------
gm030080_Glyma1 LAAKKVRRATGTDFIISLVADDFSRSSNTYVGKL--------------------------
                *:*:: *  *   ::**: .*:.    . *:***                          

AT1G25280.1     ----RSNFLGTKFLVYDTQPPPNTSSSALIT-DRTSRSRFHSRRVS--P-KV-PSGSYNI
gm003397_Glyma0 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-RFYSKKVS--P-KV-PSGSYNI
gm036752_Glyma1 ----RSNFLGTKFTIYDSQLPHTGAKIMKSR---STRL-VNLKQVS--P-KV-PTGNYPV
gm003396_Glyma0 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-RFYSKKVS--P-KV-PSGSYNI
gm021740_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-RFYSKKVS--P-KV-PSGSYNI
gm034540_Glyma1 ----SSDFLGTNFTIYDSQPPHSGAKPSSGR---ASR-RFASKQIS--P-QV-PAGNFEV
gm045744_Glyma1 SHFIRSNFLGTKFTIYD----------RKSC---STELVVNSKQVSPRP-RV-PTGNYPV
gm039266_Glyma1 ----RSNFLGTKFTILDGEPPHDSSLPLNCK---LQQ-RVHLKQVL--PNKV-SAANYKV
gm036751_Glyma1 ----RSNFLGTKFTIYDSQLPHTGAKIMKSR---STRL-VNLKQVS--P-KV-PTGNYPV
gm044959_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-RFYSKKVS--P-KV-PSGSYNI
gm030081_Glyma1 ----RSNFLGTKFTIYDSQPPHGAAIQPDSQ---PSR-RFHSKQVS--P-RV-PACNYVV
gm028526_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSR-RF-SKKVS--P-KV-PSGSYNI
gm045746_Glyma1 ----RSNFLGTKFTIYD----------RKSC---STELVVNSKQVSPRP-RV-PTGNYPV
gm028527_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSR-RF-SKKVS--P-KV-PSGSYNI
gm054928_Glyma2 ----RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSR-RF-SKKVS--P-KV-PSGSYNI
gm003395_Glyma0 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-RFYSKKVS--P-KV-PSGSYNI
gm044960_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSR-RFYSKKVS--P-KV-PSGSYNI
gm003133_Glyma0 ----RSNFLGTKFTVYDSQAPHDSAIQSNCQ---SSR-RFHSKQVS--P-RV-PACSYLV
gm004126_Glyma0 ----RSNFLGTKFTVYDAHPPIYGAKVTKSR---STRL-VSLKQVS--P-RV-PAGNYPI
gm021741_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-RFYSKKVS--P-KV-PSGSYNI
gm048089_Glyma1 ----RSNFLGTKFTILDGEPAHETSLPLNCK---LQQ-RVHLKQVL--PNKVAAAANYKV
gm037352_Glyma1 ----SSDFLGTNFTIYDSQPPHSGAKPSSGR---ASR-RFASKQIS--P-QV-PAGNFEV
gm039265_Glyma1 ----RSNFLGTKFTILDGEPPHDSSLPLNCK---LQQ-RVHLKQVL--PNKV-SAANYKV
gm044675_Glyma1 ----RSNFLGTKFTIFDSQAPNDVAIQPNCQ---SSR-RFHSKQVS--P-RL-PACNYLV
gm041730_Glyma1 ----RSNFLGTKFTIYDGQPPHAGAKIMKSR---STRL-VNLKQVS--P-KV-PTGNYPV
gm021742_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-RFYSKKVS--P-KV-PSGSYNI
gm001764_Glyma0 ----RSNFLGTKFTIYDSQPPQGAAIQPDNR---SSR-RFHSKQVS--P-RV-PACNYVV
gm054929_Glyma2 ----RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSR-RF-SKKVS--P-KV-PSGSYNI
gm045745_Glyma1 ----RSNFLGTKFTIYD----------RKSC---STELVVNSKQVSPRP-RV-PTGNYPV
gm019438_Glyma0 ----RSNFLGTKFTIYDIPLPHVGAKMTKSC---FTKL-VNPKQVS--P-RV-PTGNYPV
gm041219_Glyma1 ----RSNFLGTKFIIYDTQPPYSSAHICPPGTGKTSR-RFYSKKVS--P-KV-PSGSYNI
gm021743_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSR-RFYSKKVS--P-KV-PSGSYNI
gm030080_Glyma1 ----RSNFLGTKFTIYDSQPPHGAAIQPDSQ---PSR-RFHSKQVS--P-RV-PACNYVV
                     *:****.* : *                   .  .  :::   * :: .: .: :

AT1G25280.1     AQITYELNVLGTRGP------RRMHCIMNSIPISSLEPGGS---VPNQPEKLVPAPYSLD
gm003397_Glyma0 AQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPELL---PRSLE
gm036752_Glyma1 AHISYELNVLGSRGP------RRMHCVMDSIPATAIEPGGV---APTQ------------
gm003396_Glyma0 AQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPELL---PRSLE
gm021740_Glyma0 AQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPELL---PRPLE
gm034540_Glyma1 GQVSYKFNLLKSRGP------RRMVCSLKC-PVTP-------V-SPTS------------
gm045744_Glyma1 AHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAVAAPSQ------------
gm039266_Glyma1 ATVSYELNVLRTRGP------RRMRCMMHLIPISAIQEGGN---APTP------------
gm036751_Glyma1 AHISYELNVLGSRGP------RRMHCVMDSIPATAIEPGGV---APTQ------------
gm044959_Glyma1 AQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPELL---PRSLE
gm030081_Glyma1 STIAYELNVLRARGP------RRMHCTMNSIPVSAVQAGGN---APTP------------
gm028526_Glyma1 AQVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGV---VPGQPELL---PRALE
gm045746_Glyma1 AHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAVAAPSQ------------
gm028527_Glyma1 AQVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGV---VPGQPELL---PRALE
gm054928_Glyma2 AHVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGI---VPGQPELL---PRALE
gm003395_Glyma0 AQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPELL---PRSLE
gm044960_Glyma1 AQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPELL---PRSLE
gm003133_Glyma0 STVSYELNVLCTRGP------RRMHCVMNSIPVSAIQEGGN---APTP------------
gm004126_Glyma0 AHVSYDLNVLGSRGP------RIMQCVMDAIPASAVEPGGV---APTQ------------
gm021741_Glyma0 AQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPELL---PRPLE
gm048089_Glyma1 ATRSKANAVYDALNPHICNPRRRER----------------------P------------
gm037352_Glyma1 GQVSYKFNLLKSRGP------RRMVCSLKC-PVTPV------V-SPSV------------
gm039265_Glyma1 ATVSYELNVLRTRGP------RRMRCMMHLIPISAIQEGGN---APTP------------
gm044675_Glyma1 STVSYELNVLCTRGP------RRMYCVMNSIPVSAIQEGGN---APTP------------
gm041730_Glyma1 AHISYELNVLGSRGP------RRMHCVMDSIPAAAIEPGGV---APVQ------------
gm021742_Glyma0 AQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPELL---PRPLE
gm001764_Glyma0 STIAYELNVLRARGP------RRMHCTMNSISVSAVQEGGN---APTP------------
gm054929_Glyma2 AHVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGI---VPGQPELL---PRALE
gm045745_Glyma1 AHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAVAAPSQ------------
gm019438_Glyma0 AHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAV-APSQ------------
gm041219_Glyma1 AQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPELL---PRSLE
gm021743_Glyma0 AQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPELL---PRPLE
gm030080_Glyma1 STIAYELNVLRARGP------RRMHCTMNSIPVSAVQAGGN---APTP------------
                .  :    :  : .*      *                                      

AT1G25280.1     DSFRSNISFSKSSFDHR-----SLDFSSSRFSEMGISCDDN----EEEASFRPLILKNKQ
gm003397_Glyma0 DSFRS-ISFAR-SIDN------STEFSSSRFSDIFVAGNE-----EEQGKGRPLVLKNKS
gm036752_Glyma1 ------TEFSLNNIDMF----PSFPFFRSKSNRAENSMSGP----LVDQKDGMLVLKNKA
gm003396_Glyma0 DSFRS-ISFAR-SIDN------STEFSSSRFSDIFVAGNE-----EEQGKGRPLVLKNKS
gm021740_Glyma0 DSFRS-ISFSK-SLDR------SIEFSSSRFSEIGESIIE-----DDDGKMRPLVLKNKP
gm034540_Glyma1 ------------------GSSDSTPVNGHKMHD------------KEQAASGYTILKNKA
gm045744_Glyma1 ------TDFSVSNRDT------SFPFFQTNSTSLENSISGD----QSNKKDDVLVLRNKA
gm039266_Glyma1 ------LKFTNYLNDYASTTIPDTKGKKPEVVEFDSTGTDN-TPESIQRAREPLILKNKA
gm036751_Glyma1 ------TEFSLNNIDMF----PSFPFFRSKSNRAENSMSGP----LVDQKDGMLVLKNKA
gm044959_Glyma1 DSFRS-ISFAR-SIDN------STEFSSSRFSDIFLAGKE-----EEQGKDRPLVLKNKS
gm030081_Glyma1 ------T-FPEII-DEPFSPSPALKGKGP-IRDLDNASLPELLPVESQGSAEPLVLKNKA
gm028526_Glyma1 DSFRS-ISFSK-SIDN------STEFSSSRFSDIMGTGIE-----DEEGKVRPLVLKNKS
gm045746_Glyma1 ------TDFSVSNRDT------SFPFFQTNSTSLENSISGD----QSNKKDDVLVLRNKA
gm028527_Glyma1 DSFRS-ISFSK-SIDN------STEFSSSRFSDIMGTGIE-----DEEGKVRPLVLKNKS
gm054928_Glyma2 DSFRS-ISFSK-SIDN------STEFSSSRFSDIMGIGNE-----DEEGKVRPLVLKNKS
gm003395_Glyma0 DSFRS-ISFAR-SIDN------STEFSSSRFSDIFVAGNE-----EEQGKGRPLVLKNKS
gm044960_Glyma1 DSFRS-ISFAR-SIDN------STEFSSSRFSDIFLAGKE-----EEQGKDRPLVLKNKS
gm003133_Glyma0 ------TSFPQIF-DEPFSPSPALKEKAQ-VTDLNSASLSE-PPVLSQGSTEQLALKNKA
gm004126_Glyma0 ------TQFLHSRIDTS----PSIPFFRSKSTRMDNLPTVP----LTCQNEGTLVLRNKS
gm021741_Glyma0 DSFRS-ISFSK-SLDR------SIEFSSSRFSEIGESIIE-----DDDGKMRPLVLKNKP
gm048089_Glyma1 ------YSF-----EHASTTTPDSKGKKPEVVEFDSTGTAN-TPESIQRAREPLVLKNKA
gm037352_Glyma1 ------------------ESSDSTPVNGHKIPD------------KEQVASGYTILKNKA
gm039265_Glyma1 ------LKFTNYLNDYASTTIPDTKGKKPEVVEFDSTGTDN-TPESIQRAREPLILKNKA
gm044675_Glyma1 ------ASYPQIF-DEHFSPSPALKEKVP-VTDLNSASLSE-PPVSSQCSAEQLALKNRA
gm041730_Glyma1 ------TEFSLNNIDMF----PSFPFFRSKSNRVENSVSGP----LVDQKDGMLVLKNKA
gm021742_Glyma0 DSFRS-ISFSK-SLDR------SIEFSSSRFSEIGESIIE-----DDDGKMRPLVLKNKP
gm001764_Glyma0 ------TSFPQII-DEPFSPSPALKGKGP-IRDLDNASLPELLPVQSQDSAEPLVLKNKA
gm054929_Glyma2 DSFRS-ISFSK-SIDN------STEFSSSRFSDIMGIGNE-----DEEGKVRPLVLKNKS
gm045745_Glyma1 ------TDFSVSNRDT------SFPFFQTNSTSLENSISGD----QSNKKDDVLVLRNKA
gm019438_Glyma0 ------TDFSVSNIDT------SFPFFQTNSTSLENSISGD----QRNKKDDVLVLRNKA
gm041219_Glyma1 DSFRS-ISFSK-SLDH------SIEFSSSRFSEIGESCIE-----DDDGKMRPLVLKNKP
gm021743_Glyma0 DSFRS-ISFSK-SLDR------SIEFSSSRFSEIGESIIE-----DDDGKMRPLVLKNKP
gm030080_Glyma1 ------T-FPEII-DEPFSPSPALKGKGP-IRDLDNASLPELLPVESQGSAEPLVLKNKA
                                                                       *:*: 

AT1G25280.1     PRWHEQLQCWCLNFRGRVTVASVKNFQLVAARQPQP-QGTGAAAAPTSAPAH--PEQDKV
gm003397_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA----AGAPTPSSQPAQ--SDHDKI
gm036752_Glyma1 PRWHEQLQCWCLNFHGRVTIASVKNFQLVAS--------------AENGPAG--PEHDKI
gm003396_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA----AGAPTPSSQPAQ--SDHDKI
gm021740_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKI
gm034540_Glyma1 PRWHEHLQCWCLNFHGRVTVASVKNFQLVATVD-------------QSQPGG-KGDEETV
gm045744_Glyma1 ARWHEQLQCWCLNFHGRVTIASVKNFQLAVS--------------PENGHAG--LQEDEV
gm039266_Glyma1 PRWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE------------PCQNVSA--AEQEKV
gm036751_Glyma1 PRWHEQLQCWCLNFHGRVTIASVKNFQLVAS--------------AENGPAG--PEHDKI
gm044959_Glyma1 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA----TGAPTPSSQPAQ--SDHDKI
gm030081_Glyma1 PRWHEQLQCWCLNFKGRVTVASVKNFQLVSAVD------------PSHNVSA--AEQEKV
gm028526_Glyma1 PRWHEQLQCWCLNFRGRVTVASVKNFQLIASTPPAAVAPTGTGPTP-SQPTQSSSDPDKI
gm045746_Glyma1 ARWHEQLQCWCLNFHGRVTIASVKNFQLAVS--------------PENGHAG--LQEDEV
gm028527_Glyma1 PRWHEQLQCWCLNFRGRVTVASVKNFQLIASTPPAAVAPTGTGPTP-SQPTQSSSDPDKI
gm054928_Glyma2 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATPPPAIVTTGTGPTP-SQPTQSSSDPDKI
gm003395_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA----AGAPTPSSQPAQ--SDHDKI
gm044960_Glyma1 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA----TGAPTPSSQPAQ--SDHDKI
gm003133_Glyma0 PRWHEQLQCWCLNFKGRVSVASVKNFQLVAAVD------------PSHNISA--EEQEKV
gm004126_Glyma0 PRWHEHLQCWCLNFNGRVTVASVKNFQLVAS--------------PKNGVSE--QAQENV
gm021741_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKI
gm048089_Glyma1 PRWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE------------PCQNVSA--AEQEKV
gm037352_Glyma1 PRWHEHLQCWCLNFHGRVTVASVKNFQLVATVD-------------QSQPGG-KGDEETV
gm039265_Glyma1 PRWHEQLQCWCLNFKGRVTVASVKNFQLVAAAE------------PCQNVSA--AEQEKV
gm044675_Glyma1 PRWHEQLQCWCLNFKGRVSVASVKNFQLVAAVD------------PSHNISA--EEQEKV
gm041730_Glyma1 PRWHEQLQCWCLNFHGRVTIASVKNFQLVAS--------------AENRPAG--PEHDKI
gm021742_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKI
gm001764_Glyma0 PRWHEQLQCWCLNFNGRVTVASVKNFQLVAAVD------------PSHNVSA--AEQEKV
gm054929_Glyma2 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATPPPAIVTTGTGPTP-SQPTQSSSDPDKI
gm045745_Glyma1 ARWHEQLQCWCLNFHGRVTIASVKNFQLAVS--------------PENGHAG--LQEDEV
gm019438_Glyma0 ARWHEQLECWCLNFHGRVTIASVKNFQLAVS--------------PENGHAG--PQEDEV
gm041219_Glyma1 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAA-----GAPTP-SQPAP--PEHDKI
gm021743_Glyma0 PRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKI
gm030080_Glyma1 PRWHEQLQCWCLNFKGRVTVASVKNFQLVSAVD------------PSHNVSA--AEQEKV
                .****:*:******.***::********  :                          : :

AT1G25280.1     ILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm003397_Glyma0 ILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm036752_Glyma1 ILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTKIACE
gm003396_Glyma0 ILQFGK--QTIYVL---LPCSVMGFFLW------------
gm021740_Glyma0 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm034540_Glyma1 LLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTKLACE
gm045744_Glyma1 ILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm039266_Glyma1 ILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm036751_Glyma1 ILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTKIACE
gm044959_Glyma1 ILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm030081_Glyma1 ILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm028526_Glyma1 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm045746_Glyma1 ILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm028527_Glyma1 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm054928_Glyma2 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm003395_Glyma0 ILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm044960_Glyma1 ILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm003133_Glyma0 ILQFGKIGKDIFTMDYCYPLSTFQAFAICLSSFDTKPACE
gm004126_Glyma0 ILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
gm021741_Glyma0 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm048089_Glyma1 ILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm037352_Glyma1 LLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTKLACE
gm039265_Glyma1 ILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm044675_Glyma1 ILQFGKIGKDIFTMDYCYPLSTFQAFAICLSSFDTKPACE
gm041730_Glyma1 ILQFGKVGKDLFTMDYRFPISAFQAFAICLSSFDTKIACE
gm021742_Glyma0 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm001764_Glyma0 ILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm054929_Glyma2 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm045745_Glyma1 ILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm019438_Glyma0 ILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm041219_Glyma1 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm021743_Glyma0 ILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm030080_Glyma1 ILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
                :*****  .  :.:    * *.:  *              


BoxShade v3.31 C (beta, 970507) Output
AT1G25280.1     M S F R G I V Q D L R - - - D G F G S L S R R S F D F R L S S L H K G K A Q G - - - - S S F R E Y S S S R D - - L L S P
gm003397_Glyma0    M S F R S I V R D V R - - - D G F G S L S R R S F D V R I S G G - - G K L N S - - - - L V H E A H E - - - - - - - - R Q
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    M S F R S I V R D V R - - - D G F G S L S R R S F D V R I S G G - - G K L N S - - - - L V H E A H E - - - - - - - - R Q
gm021740_Glyma0    M S F R S I V R D V R - - - D S F G S L S R R S F D V R L T G H H R G K S Q G - - - - S V Q D L H D - - - - - - - - Q P
gm034540_Glyma1    M S L R K V F R S R K - - - - - - - - F S K S F K E V L - - - P A E G A A V - - - E G G V A G T V E E A A N G - - - - -
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I E V Q - - - - - - - - - - A
gm039266_Glyma1    M P F R S I V R E L K E I G E G I S N M Y R R G G E A K - - - H V H R H G K S - - - - H I A P E C S - - - - - - L P P P
gm036751_Glyma1    - - - - - M G - - - - - - - - - - - - L I R - - - - - - - - - S M R S R S Q - - - - - R V V Q E Q E A A E C V G V V V G
gm044959_Glyma1    M S F R S I V R D V R - - - D G F G S L S R R S F D V R L S G G - - G K S N S - - - - L V H E E H E - - - - - - - - C L
gm030081_Glyma1    M S L K S I V R E L K E M R D G I G S M S R R G V E S R - - - R W N G R T K S - - - - H V A P D V T - - - - - - L T S L
gm028526_Glyma1    M S F R S I V R E V R - - - D G F G S L S R R S F E V R L P G H N R G K S R S - - - - L V H E L Q D - - - - - - - - Q P
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I E V Q - - - - - - - - - - A
gm028527_Glyma1    M S F R S I V R E V R - - - D G F G S L S R R S F E V R L P G H N R G K S R S - - - - L V H E L Q D - - - - - - - - Q P
gm054928_Glyma2    M S F R S I V R D V R - - - D G F G S L S R R S F E V R L P G H N R G K S R S - - - - S V H E L Q D - - - - - - - - Q P
gm003395_Glyma0    M S F R S I V R D V R - - - D G F G S L S R R S F D V R I S G G - - G K L N S - - - - L V H E A H E - - - - - - - - R Q
gm044960_Glyma1    M S F R S I V R D V R - - - D G F G S L S R R S F D V R L S G G - - G K S N S - - - - L V H E E H E - - - - - - - - C L
gm003133_Glyma0    M S L R S I V R E L K E M R D G I G S T S K R G A E S K - - - H R L S R T K S - - - - H V A P D V L - - - - - - A T P F
gm004126_Glyma0    M S F R S I I - - - - - - - - - - - - L E R K G F E V K F G Y S M R S R S Q S H - S D A I A Q D S - - - - - - - L V V L
gm021741_Glyma0    M S F R S I V R D V R - - - D S F G S L S R R S F D V R L T G H H R G K S Q G - - - - S V Q D L H D - - - - - - - - Q P
gm048089_Glyma1    M P F R S I V R E L K E I G E G I S N M Y R R G G E A K - - - H V H R H G K S - - - - H I A P E C S - - - - - - L P P P
gm037352_Glyma1    M S L R K V F R S R K - - - - - - - - F S R S F K E V L - - - P A E G A A I V G G E D G V A G A G E E S S N G - - - - -
gm039265_Glyma1    M P F R S I V R E L K E I G E G I S N M Y R R G G E A K - - - H V H R H G K S - - - - H I A P E C S - - - - - - L P P P
gm044675_Glyma1    M S L R S I V R E L K E M R D G I G S T S K R G A E S K - - - H W L S R T K S - - - - H V A P D I L - - - - - - A T P F
gm041730_Glyma1    - - - - - M C - - - - - - - - - - - - L I R - - - - - - - - - S M R S Q S Q - - - - - R V V Q E Q E E A E C - - - - V G
gm021742_Glyma0    M S F R S I V R D V R - - - D S F G S L S R R S F D V R L T G H H R G K S Q G - - - - S V Q D L H D - - - - - - - - Q P
gm001764_Glyma0    M S L K S I V R E L K E M R D G I G S M S R R G V E S R - - - R W N G R T K S - - - - H V A P D V I - - - - - - L T S L
gm054929_Glyma2    M S F R S I V R D V R - - - D G F G S L S R R S F E V R L P G H N R G K S R S - - - - S V H E L Q D - - - - - - - - Q P
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I E V Q - - - - - - - - - - A
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041219_Glyma1    M S F R S I V R D V R - - - D S F G S L S R R S F D V R L T G H H R G K S Q G - - - - S V Q D L H D - - - - - - - - Q P
gm021743_Glyma0    M S F R S I V R D V R - - - D S F G S L S R R S F D V R L T G H H R G K S Q G - - - - S V Q D L H D - - - - - - - - Q P
gm030080_Glyma1    M S L K S I V R E L K E M R D G I G S M S R R G V E S R - - - R W N G R T K S - - - - H V A P D V T - - - - - - L T S L
 
AT1G25280.1     V I V Q - - - - - - - - - T S R W A N L P P E L L F D V I K R L E E S E S N W P A R K H V V A C A S V C R S W - R A M C
gm003397_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M C
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M C
gm021740_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C
gm034540_Glyma1    - - - - - - - - - - - - N N N G W S S M L P E I L G E I V R R V D A A E E Q W P N R Q N V V A C A C V C K R W - R D I T
gm045744_Glyma1    N A M E - - - - - - - - - Q S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I V
gm039266_Glyma1    P P P P P S S S S - - - - Q S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C R L W - R E I T
gm036751_Glyma1    D S M R - - - - - - - - - Q S C W A N M P Q E L L R E V L L R I E A S E D T W P P R K S V V S C A G V C R S W - R H I T
gm044959_Glyma1    P V V Q - - - - - - - - - N S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V V A C A A V C R S W - R G M C
gm030081_Glyma1    E P I Q - - - - - - - - - Q G H W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V T
gm028526_Glyma1    P V I Q - - - - - - - - - N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C
gm045746_Glyma1    N A M E - - - - - - - - - Q S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I V
gm028527_Glyma1    P V I Q - - - - - - - - - N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C
gm054928_Glyma2    P V I Q - - - - - - - - - N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C
gm003395_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M C
gm044960_Glyma1    P V V Q - - - - - - - - - N S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V V A C A A V C R S W - R G M C
gm003133_Glyma0    E P I Q - - - - - - - - - Q G Q W A N L P S E L L L D I I Q R V E E S E T S W P A R A V V V F C A S V C K S W - R S I T
gm004126_Glyma0    D G L K - - - - - - - - - Q S C W A N M P P E L L R D V L M R I E A S E D S W P A Q K H V V A C A G V C R S W - R E I M
gm021741_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C
gm048089_Glyma1    P S S S S S S S S S S S W Q S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C K L W - R E I T
gm037352_Glyma1    - - - - - - - - - - - - - N N G W S N M L P E I L G E I V R R V D A A E E Q W P N R Q N V V A C A C V C K R W - R D I T
gm039265_Glyma1    P P P P P S S S S - - - - Q S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C R L W - R E I T
gm044675_Glyma1    E P I Q - - - - - - - - - Q G Q W A N L P S E L L L D I I Q R I E E S E T S W P A R A V V V F C A S V C K S W - R S I T
gm041730_Glyma1    D S M R - - - - - - - - - Q S C W A N M P Q E L L R E V L F R I E A S E D A W P P R K S V V A C A G V C R S W - R Q I T
gm021742_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C
gm001764_Glyma0    E P I Q - - - - - - - - - Q G Q W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V T
gm054929_Glyma2    P V I Q - - - - - - - - - N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M C
gm045745_Glyma1    N A M E - - - - - - - - - Q S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I V
gm019438_Glyma0    - - M E - - - - - - - - - Q S W R A N M P R E L L R E V L L R I E S S E A T W P S R R S V V A C G G V C R T W - R L I V
gm041219_Glyma1    L V I Q - - - - - - - - - N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C
gm021743_Glyma0    L V I Q - - - - - - - - - N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M C
gm030080_Glyma1    E P I Q - - - - - - - - - Q G H W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V T
 
AT1G25280.1     Q E I V L G P E I C G K L T F P V S L K Q P G P R D A M I Q C F I K R D K S K L T F H L F L C L S P A L L V E N G K F L
gm003397_Glyma0    K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - M P G P R E N L L R C F I K R N R S T Q T Y Y L F L S L T S T L - A E D G K F L
gm003396_Glyma0    K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm021740_Glyma0    K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm034540_Glyma1    R E V V R V P S H T G K I T F P S C L K Q P G P R D V P H Q C L I K R N Q K T S T F Y L Y L A L T P S F - T D K G K F L
gm045744_Glyma1    K E I V K P P Q F S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A L V A D D G K F L
gm039266_Glyma1    K D V I K T P E Q C G L L T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A L S G D M S K L L
gm036751_Glyma1    K D I V K T P E L S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S T Q T Y Y L F L S L T S T L - A E D G K F L
gm044959_Glyma1    K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm030081_Glyma1    K E I V K T P E Q C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - E N E T D K L L
gm028526_Glyma1    K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L G L S P A L L V E N G K F L
gm045746_Glyma1    K E I V K P P Q F S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A L V A D D G K F L
gm028527_Glyma1    K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L G L S P A L L V E N G K F L
gm054928_Glyma2    K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L C L S P A L L V E N G K F L
gm003395_Glyma0    K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm044960_Glyma1    K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm003133_Glyma0    R E I V K T P E Q C G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y F G L V P S - E N D S N K L L
gm004126_Glyma0    K E I V K S P Q L S G K L T F P I S L K Q P G P R D S L L Q C Y I K R N R S N Q T Y Y L F L G L N Q A S - T D E G K F L
gm021741_Glyma0    K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm048089_Glyma1    K D V V K T P E Q C G F I T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A L S G D M S K L L
gm037352_Glyma1    R E V V R V P S H T G K I T F P A C L K Q P G P R D V P H Q C L I K R N K K T S T F Y L Y L A L T P S F - T D K G K F L
gm039265_Glyma1    K D V I K T P E Q C G L L T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A L S G D M S K L L
gm044675_Glyma1    R E I V K T P E Q C G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y F G L V P S - E N D G N K L L
gm041730_Glyma1    I D I V K T P E L S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S S Q T Y Y L Y L S L T N T L - A E D G K F L
gm021742_Glyma0    K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm001764_Glyma0    K E I V K T P E Q C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - E N E T D K L L
gm054929_Glyma2    K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L C L S P A L L V E N G K F L
gm045745_Glyma1    K E I V K P P Q F S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A L V A D D G K F L
gm019438_Glyma0    K E I V K P P Q L S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A T Q T Y Y L F L S L S S A L I A D D G K F L
gm041219_Glyma1    K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm021743_Glyma0    K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K F L
gm030080_Glyma1    K E I V K T P E Q C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - E N E T D K L L
 
AT1G25280.1     L S A K R T R R T T R T E Y I I S M D A D N I S R S S N S Y L G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036752_Glyma1    L A A R K C R R P T C T D Y I I S L D A D D M S K G S N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021740_Glyma0    L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm034540_Glyma1    L A A R R Y R C G T H T E Y I I S L D A D D L S Q G S N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045744_Glyma1    L A A R K F R R P T C T D Y I I S L D A D D M S R E S N A Y V G K L R S T L N Q I L L L A I L L F L F L S A K T N P L S
gm039266_Glyma1    L A A K K I R R A T C T E F I I S L V A D D F S R A C D T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    L A A R K C R R P T C T D Y I I S L D A D D M S K G S N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044959_Glyma1    L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030081_Glyma1    L A A K K V R R A T G T D F I I S L V A D D F S R S S N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028526_Glyma1    L S A K R T R R T T C T E Y V I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045746_Glyma1    L A A R K F R R P T C T D Y I I S L D A D D M S R E S N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028527_Glyma1    L S A K R T R R T T C T E Y V I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054928_Glyma2    L S A K R T R R T T C T E Y I I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003395_Glyma0    L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044960_Glyma1    L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003133_Glyma0    L A A K R I R R A T G T G F V I S L A A D D F S R A S N K Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm004126_Glyma0    L S A R K C R R A T H T D Y I I S L N C D D V S R G S S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm048089_Glyma1    L A A K K I R R A T C T E F I I S L V S D D F S W A S N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm037352_Glyma1    L A A R R Y R C G T H T E Y I I S L D A D D L S Q G S N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039265_Glyma1    L A A K K I R R A T C T E F I I S L V A D D F S R A C D T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044675_Glyma1    L A A K R I R R A T G T D F I I S L A A D D F S R A S N K Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041730_Glyma1    L A A R K C R R P T C T D Y I I S L D A D D M S K G S N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021742_Glyma0    L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    L A A K K V R R A T G T D F V I S L V A D D F F R S S N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054929_Glyma2    L S A K R T R R T T C T E Y I I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045745_Glyma1    L A A R K F R R P T C T D Y I I S L D A D D M S R E S N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm019438_Glyma0    L A A R K F R R P T C I D Y I I S L D A D D M S R E S N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041219_Glyma1    L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021743_Glyma0    L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030080_Glyma1    L A A K K V R R A T G T D F I I S L V A D D F S R S S N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
 
AT1G25280.1     - - - - R S N F L G T K F L V Y D T Q P P P N T S S S A L I T - D R T S R S R F H S R R V S - - P - K V - P S G S Y N I
gm003397_Glyma0    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm036752_Glyma1    - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K S R - - - S T R L - V N L K Q V S - - P - K V - P T G N Y P V
gm003396_Glyma0    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm021740_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm034540_Glyma1    - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S G R - - - A S R - R F A S K Q I S - - P - Q V - P A G N F E V
gm045744_Glyma1    S H F I R S N F L G T K F T I Y D - - - - - - - - - - R K S C - - - S T E L V V N S K Q V S P R P - R V - P T G N Y P V
gm039266_Glyma1    - - - - R S N F L G T K F T I L D G E P P H D S S L P L N C K - - - L Q Q - R V H L K Q V L - - P N K V - S A A N Y K V
gm036751_Glyma1    - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K S R - - - S T R L - V N L K Q V S - - P - K V - P T G N Y P V
gm044959_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm030081_Glyma1    - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P D S Q - - - P S R - R F H S K Q V S - - P - R V - P A C N Y V V
gm028526_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R - R F - S K K V S - - P - K V - P S G S Y N I
gm045746_Glyma1    - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K S C - - - S T E L V V N S K Q V S P R P - R V - P T G N Y P V
gm028527_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R - R F - S K K V S - - P - K V - P S G S Y N I
gm054928_Glyma2    - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R - R F - S K K V S - - P - K V - P S G S Y N I
gm003395_Glyma0    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm044960_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm003133_Glyma0    - - - - R S N F L G T K F T V Y D S Q A P H D S A I Q S N C Q - - - S S R - R F H S K Q V S - - P - R V - P A C S Y L V
gm004126_Glyma0    - - - - R S N F L G T K F T V Y D A H P P I Y G A K V T K S R - - - S T R L - V S L K Q V S - - P - R V - P A G N Y P I
gm021741_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm048089_Glyma1    - - - - R S N F L G T K F T I L D G E P A H E T S L P L N C K - - - L Q Q - R V H L K Q V L - - P N K V A A A A N Y K V
gm037352_Glyma1    - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S G R - - - A S R - R F A S K Q I S - - P - Q V - P A G N F E V
gm039265_Glyma1    - - - - R S N F L G T K F T I L D G E P P H D S S L P L N C K - - - L Q Q - R V H L K Q V L - - P N K V - S A A N Y K V
gm044675_Glyma1    - - - - R S N F L G T K F T I F D S Q A P N D V A I Q P N C Q - - - S S R - R F H S K Q V S - - P - R L - P A C N Y L V
gm041730_Glyma1    - - - - R S N F L G T K F T I Y D G Q P P H A G A K I M K S R - - - S T R L - V N L K Q V S - - P - K V - P T G N Y P V
gm021742_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm001764_Glyma0    - - - - R S N F L G T K F T I Y D S Q P P Q G A A I Q P D N R - - - S S R - R F H S K Q V S - - P - R V - P A C N Y V V
gm054929_Glyma2    - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R - R F - S K K V S - - P - K V - P S G S Y N I
gm045745_Glyma1    - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K S C - - - S T E L V V N S K Q V S P R P - R V - P T G N Y P V
gm019438_Glyma0    - - - - R S N F L G T K F T I Y D I P L P H V G A K M T K S C - - - F T K L - V N P K Q V S - - P - R V - P T G N Y P V
gm041219_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y S S A H I C P P G T G K T S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm021743_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R - R F Y S K K V S - - P - K V - P S G S Y N I
gm030080_Glyma1    - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P D S Q - - - P S R - R F H S K Q V S - - P - R V - P A C N Y V V
 
AT1G25280.1     A Q I T Y E L N V L G T R G P - - - - - - R R M H C I M N S I P I S S L E P G G S - - - V P N Q P E K L V P A P Y S L D
gm003397_Glyma0    A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E L L - - - P R S L E
gm036752_Glyma1    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A T A I E P G G V - - - A P T Q - - - - - - - - - - - -
gm003396_Glyma0    A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E L L - - - P R S L E
gm021740_Glyma0    A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E L L - - - P R P L E
gm034540_Glyma1    G Q V S Y K F N L L K S R G P - - - - - - R R M V C S L K C - P V T P - - - - - - - V - S P T S - - - - - - - - - - - -
gm045744_Glyma1    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V A A P S Q - - - - - - - - - - - -
gm039266_Glyma1    A T V S Y E L N V L R T R G P - - - - - - R R M R C M M H L I P I S A I Q E G G N - - - A P T P - - - - - - - - - - - -
gm036751_Glyma1    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A T A I E P G G V - - - A P T Q - - - - - - - - - - - -
gm044959_Glyma1    A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E L L - - - P R S L E
gm030081_Glyma1    S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I P V S A V Q A G G N - - - A P T P - - - - - - - - - - - -
gm028526_Glyma1    A Q V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P N G V - - - V P G Q P E L L - - - P R A L E
gm045746_Glyma1    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V A A P S Q - - - - - - - - - - - -
gm028527_Glyma1    A Q V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P N G V - - - V P G Q P E L L - - - P R A L E
gm054928_Glyma2    A H V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P N G I - - - V P G Q P E L L - - - P R A L E
gm003395_Glyma0    A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E L L - - - P R S L E
gm044960_Glyma1    A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E L L - - - P R S L E
gm003133_Glyma0    S T V S Y E L N V L C T R G P - - - - - - R R M H C V M N S I P V S A I Q E G G N - - - A P T P - - - - - - - - - - - -
gm004126_Glyma0    A H V S Y D L N V L G S R G P - - - - - - R I M Q C V M D A I P A S A V E P G G V - - - A P T Q - - - - - - - - - - - -
gm021741_Glyma0    A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E L L - - - P R P L E
gm048089_Glyma1    A T R S K A N A V Y D A L N P H I C N P R R R E R - - - - - - - - - - - - - - - - - - - - - - P - - - - - - - - - - - -
gm037352_Glyma1    G Q V S Y K F N L L K S R G P - - - - - - R R M V C S L K C - P V T P V - - - - - - V - S P S V - - - - - - - - - - - -
gm039265_Glyma1    A T V S Y E L N V L R T R G P - - - - - - R R M R C M M H L I P I S A I Q E G G N - - - A P T P - - - - - - - - - - - -
gm044675_Glyma1    S T V S Y E L N V L C T R G P - - - - - - R R M Y C V M N S I P V S A I Q E G G N - - - A P T P - - - - - - - - - - - -
gm041730_Glyma1    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A A A I E P G G V - - - A P V Q - - - - - - - - - - - -
gm021742_Glyma0    A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E L L - - - P R P L E
gm001764_Glyma0    S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I S V S A V Q E G G N - - - A P T P - - - - - - - - - - - -
gm054929_Glyma2    A H V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P N G I - - - V P G Q P E L L - - - P R A L E
gm045745_Glyma1    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V A A P S Q - - - - - - - - - - - -
gm019438_Glyma0    A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V - A P S Q - - - - - - - - - - - -
gm041219_Glyma1    A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E L L - - - P R S L E
gm021743_Glyma0    A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E L L - - - P R P L E
gm030080_Glyma1    S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I P V S A V Q A G G N - - - A P T P - - - - - - - - - - - -
 
AT1G25280.1     D S F R S N I S F S K S S F D H R - - - - - S L D F S S S R F S E M G I S C D D N - - - - E E E A S F R P L I L K N K Q
gm003397_Glyma0    D S F R S - I S F A R - S I D N - - - - - - S T E F S S S R F S D I F V A G N E - - - - - E E Q G K G R P L V L K N K S
gm036752_Glyma1    - - - - - - T E F S L N N I D M F - - - - P S F P F F R S K S N R A E N S M S G P - - - - L V D Q K D G M L V L K N K A
gm003396_Glyma0    D S F R S - I S F A R - S I D N - - - - - - S T E F S S S R F S D I F V A G N E - - - - - E E Q G K G R P L V L K N K S
gm021740_Glyma0    D S F R S - I S F S K - S L D R - - - - - - S I E F S S S R F S E I G E S I I E - - - - - D D D G K M R P L V L K N K P
gm034540_Glyma1    - - - - - - - - - - - - - - - - - - G S S D S T P V N G H K M H D - - - - - - - - - - - - K E Q A A S G Y T I L K N K A
gm045744_Glyma1    - - - - - - T D F S V S N R D T - - - - - - S F P F F Q T N S T S L E N S I S G D - - - - Q S N K K D D V L V L R N K A
gm039266_Glyma1    - - - - - - L K F T N Y L N D Y A S T T I P D T K G K K P E V V E F D S T G T D N - T P E S I Q R A R E P L I L K N K A
gm036751_Glyma1    - - - - - - T E F S L N N I D M F - - - - P S F P F F R S K S N R A E N S M S G P - - - - L V D Q K D G M L V L K N K A
gm044959_Glyma1    D S F R S - I S F A R - S I D N - - - - - - S T E F S S S R F S D I F L A G K E - - - - - E E Q G K D R P L V L K N K S
gm030081_Glyma1    - - - - - - T - F P E I I - D E P F S P S P A L K G K G P - I R D L D N A S L P E L L P V E S Q G S A E P L V L K N K A
gm028526_Glyma1    D S F R S - I S F S K - S I D N - - - - - - S T E F S S S R F S D I M G T G I E - - - - - D E E G K V R P L V L K N K S
gm045746_Glyma1    - - - - - - T D F S V S N R D T - - - - - - S F P F F Q T N S T S L E N S I S G D - - - - Q S N K K D D V L V L R N K A
gm028527_Glyma1    D S F R S - I S F S K - S I D N - - - - - - S T E F S S S R F S D I M G T G I E - - - - - D E E G K V R P L V L K N K S
gm054928_Glyma2    D S F R S - I S F S K - S I D N - - - - - - S T E F S S S R F S D I M G I G N E - - - - - D E E G K V R P L V L K N K S
gm003395_Glyma0    D S F R S - I S F A R - S I D N - - - - - - S T E F S S S R F S D I F V A G N E - - - - - E E Q G K G R P L V L K N K S
gm044960_Glyma1    D S F R S - I S F A R - S I D N - - - - - - S T E F S S S R F S D I F L A G K E - - - - - E E Q G K D R P L V L K N K S
gm003133_Glyma0    - - - - - - T S F P Q I F - D E P F S P S P A L K E K A Q - V T D L N S A S L S E - P P V L S Q G S T E Q L A L K N K A
gm004126_Glyma0    - - - - - - T Q F L H S R I D T S - - - - P S I P F F R S K S T R M D N L P T V P - - - - L T C Q N E G T L V L R N K S
gm021741_Glyma0    D S F R S - I S F S K - S L D R - - - - - - S I E F S S S R F S E I G E S I I E - - - - - D D D G K M R P L V L K N K P
gm048089_Glyma1    - - - - - - Y S F - - - - - E H A S T T T P D S K G K K P E V V E F D S T G T A N - T P E S I Q R A R E P L V L K N K A
gm037352_Glyma1    - - - - - - - - - - - - - - - - - - E S S D S T P V N G H K I P D - - - - - - - - - - - - K E Q V A S G Y T I L K N K A
gm039265_Glyma1    - - - - - - L K F T N Y L N D Y A S T T I P D T K G K K P E V V E F D S T G T D N - T P E S I Q R A R E P L I L K N K A
gm044675_Glyma1    - - - - - - A S Y P Q I F - D E H F S P S P A L K E K V P - V T D L N S A S L S E - P P V S S Q C S A E Q L A L K N R A
gm041730_Glyma1    - - - - - - T E F S L N N I D M F - - - - P S F P F F R S K S N R V E N S V S G P - - - - L V D Q K D G M L V L K N K A
gm021742_Glyma0    D S F R S - I S F S K - S L D R - - - - - - S I E F S S S R F S E I G E S I I E - - - - - D D D G K M R P L V L K N K P
gm001764_Glyma0    - - - - - - T S F P Q I I - D E P F S P S P A L K G K G P - I R D L D N A S L P E L L P V Q S Q D S A E P L V L K N K A
gm054929_Glyma2    D S F R S - I S F S K - S I D N - - - - - - S T E F S S S R F S D I M G I G N E - - - - - D E E G K V R P L V L K N K S
gm045745_Glyma1    - - - - - - T D F S V S N R D T - - - - - - S F P F F Q T N S T S L E N S I S G D - - - - Q S N K K D D V L V L R N K A
gm019438_Glyma0    - - - - - - T D F S V S N I D T - - - - - - S F P F F Q T N S T S L E N S I S G D - - - - Q R N K K D D V L V L R N K A
gm041219_Glyma1    D S F R S - I S F S K - S L D H - - - - - - S I E F S S S R F S E I G E S C I E - - - - - D D D G K M R P L V L K N K P
gm021743_Glyma0    D S F R S - I S F S K - S L D R - - - - - - S I E F S S S R F S E I G E S I I E - - - - - D D D G K M R P L V L K N K P
gm030080_Glyma1    - - - - - - T - F P E I I - D E P F S P S P A L K G K G P - I R D L D N A S L P E L L P V E S Q G S A E P L V L K N K A
 
AT1G25280.1     P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A R Q P Q P - Q G T G A A A A P T S A P A H - - P E Q D K V
gm003397_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - A G A P T P S S Q P A Q - - S D H D K I
gm036752_Glyma1    P R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L V A S - - - - - - - - - - - - - - A E N G P A G - - P E H D K I
gm003396_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - A G A P T P S S Q P A Q - - S D H D K I
gm021740_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I
gm034540_Glyma1    P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A T V D - - - - - - - - - - - - - Q S Q P G G - K G D E E T V
gm045744_Glyma1    A R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L A V S - - - - - - - - - - - - - - P E N G H A G - - L Q E D E V
gm039266_Glyma1    P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A A E - - - - - - - - - - - - P C Q N V S A - - A E Q E K V
gm036751_Glyma1    P R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L V A S - - - - - - - - - - - - - - A E N G P A G - - P E H D K I
gm044959_Glyma1    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - T G A P T P S S Q P A Q - - S D H D K I
gm030081_Glyma1    P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V S A V D - - - - - - - - - - - - P S H N V S A - - A E Q E K V
gm028526_Glyma1    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A S T P P A A V A P T G T G P T P - S Q P T Q S S S D P D K I
gm045746_Glyma1    A R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L A V S - - - - - - - - - - - - - - P E N G H A G - - L Q E D E V
gm028527_Glyma1    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A S T P P A A V A P T G T G P T P - S Q P T Q S S S D P D K I
gm054928_Glyma2    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T P P P A I V T T G T G P T P - S Q P T Q S S S D P D K I
gm003395_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - A G A P T P S S Q P A Q - - S D H D K I
gm044960_Glyma1    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - T G A P T P S S Q P A Q - - S D H D K I
gm003133_Glyma0    P R W H E Q L Q C W C L N F K G R V S V A S V K N F Q L V A A V D - - - - - - - - - - - - P S H N I S A - - E E Q E K V
gm004126_Glyma0    P R W H E H L Q C W C L N F N G R V T V A S V K N F Q L V A S - - - - - - - - - - - - - - P K N G V S E - - Q A Q E N V
gm021741_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I
gm048089_Glyma1    P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A A E - - - - - - - - - - - - P C Q N V S A - - A E Q E K V
gm037352_Glyma1    P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A T V D - - - - - - - - - - - - - Q S Q P G G - K G D E E T V
gm039265_Glyma1    P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A A E - - - - - - - - - - - - P C Q N V S A - - A E Q E K V
gm044675_Glyma1    P R W H E Q L Q C W C L N F K G R V S V A S V K N F Q L V A A V D - - - - - - - - - - - - P S H N I S A - - E E Q E K V
gm041730_Glyma1    P R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L V A S - - - - - - - - - - - - - - A E N R P A G - - P E H D K I
gm021742_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I
gm001764_Glyma0    P R W H E Q L Q C W C L N F N G R V T V A S V K N F Q L V A A V D - - - - - - - - - - - - P S H N V S A - - A E Q E K V
gm054929_Glyma2    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T P P P A I V T T G T G P T P - S Q P T Q S S S D P D K I
gm045745_Glyma1    A R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L A V S - - - - - - - - - - - - - - P E N G H A G - - L Q E D E V
gm019438_Glyma0    A R W H E Q L E C W C L N F H G R V T I A S V K N F Q L A V S - - - - - - - - - - - - - - P E N G H A G - - P Q E D E V
gm041219_Glyma1    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P A A - - - - - G A P T P - S Q P A P - - P E H D K I
gm021743_Glyma0    P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I
gm030080_Glyma1    P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V S A V D - - - - - - - - - - - - P S H N V S A - - A E Q E K V
 
AT1G25280.1     I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm003397_Glyma0    I L Q F G K V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm036752_Glyma1    I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
gm003396_Glyma0    I L Q F G K - - Q T I Y V L - - - L P C S V M G F F L W - - - - - - - - - - - -
gm021740_Glyma0    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm034540_Glyma1    L L Q F G K V G D D T F T M D Y R Q P L S A F Q A F A I C L T S F G T K L A C E
gm045744_Glyma1    I L Q F G K I G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm039266_Glyma1    I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm036751_Glyma1    I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
gm044959_Glyma1    I L Q F G K V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm030081_Glyma1    I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm028526_Glyma1    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm045746_Glyma1    I L Q F G K I G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm028527_Glyma1    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm054928_Glyma2    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm003395_Glyma0    I L Q F G K V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm044960_Glyma1    I L Q F G K V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm003133_Glyma0    I L Q F G K I G K D I F T M D Y C Y P L S T F Q A F A I C L S S F D T K P A C E
gm004126_Glyma0    I L Q F G K V G K D V F T M D Y Q Y P I S A F Q A F A I C L S S F D T K I A C E
gm021741_Glyma0    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm048089_Glyma1    I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm037352_Glyma1    L L Q F G K V G D D T F T M D Y R Q P L S A F Q A F A I C L T S F G T K L A C E
gm039265_Glyma1    I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm044675_Glyma1    I L Q F G K I G K D I F T M D Y C Y P L S T F Q A F A I C L S S F D T K P A C E
gm041730_Glyma1    I L Q F G K V G K D L F T M D Y R F P I S A F Q A F A I C L S S F D T K I A C E
gm021742_Glyma0    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm001764_Glyma0    I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm054929_Glyma2    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm045745_Glyma1    I L Q F G K I G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm019438_Glyma0    I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm041219_Glyma1    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm021743_Glyma0    I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm030080_Glyma1    I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
 
0