fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G43640.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os021774 not found in 445aa AT1G25280.1 1st_not 0.628536285 II
Sb032660 ACQGAALRLSLAFLDS in 197/692 AT1G25280.1 1st_not 0.626076260 II
SPLIMGLSLMLAGQAE in 382/692
Gm041219 not found in 427aa AT1G25280.1 1st_not 0.686346863 II
Pt039357 not found in 424aa AT1G76900.2 1st_not 0.690036900 II
Pp034735 not found in 483aa AT2G47900.2 1st_not 0.506765067 II
Sm012016 ATSTYHLCLGLSPNFD in 155/430 AT2G47900.2 1st_not 0.504305043 II

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G43640.1     ---------------------------------------------------------MSF
Sm012016_Selmo1 ---------------------------------------------MSGKKSSSSSSLLPL
pt039357_POPTR_ ---------------------------------------------------------MSF
Sb032660_Sorbi1 ------------------------------------------------------LAKMSF
gm041219_Glyma1 ---------------------------------------------------------MSF
Os021774_Os05t0 ---------------------------------------------------------MSF
pp034735_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRR--SGSSMMPL
                                                                         :.:

AT1G43640.1     LSIVR---DVRDTVGSFSRRSFDVRVSN--GTT-HQRSKSHGVEAH---IEDL-IVIKNT
Sm012016_Selmo1 RSILREFQDIRDGIGSLSRRSFEVRLPY------HHRSRSHSVVLDEPPVRDV-VVLQQS
pt039357_POPTR_ RSIVR---DMRDGFGSLSRRSFEVRLPG------HLRGKSHGSACE---LQDQPVVIQNS
Sb032660_Sorbi1 RSIVR---DVRDSFGSLSRRSFEVTIAGLSGLTVHHRGKSQSTVHE---VCDTDLIIQES
gm041219_Glyma1 RSIVR---DVRDSFGSLSRRSFDVRLTG------HHRGKSQGSVQD---LHDQPLVIQNS
Os021774_Os05t0 RSIVR---DVRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTVHE---LCDADLIIQES
pp034735_Pp1s15 KSLIREFQEMKGGRGGISRRSFELKFPH------HHKGRSSGMVLDESQLRVE-AVVKQS
                 *::*   :::.  *.:*****:: ..       * :.:* .   .   :     :::::

AT1G43640.1     RWANLPAALLRDVMKKLDESESTWPARKQVVACAGVCKTWRLMCKDIVKSPEFSGKLTFP
Sm012016_Selmo1 RWASMPPELLRDVIQRLESSEHTWPARKNVVVCAEVCSQWRDIAKELVKTPEQSGKLTFP
pt039357_POPTR_ RWAGLPPELLQDVIKRLEASESTWPSRKHVVACASVCRAWREMCKEIVRSPEFSGKITFP
Sb032660_Sorbi1 RWANLPPELLRDVIRRLEASESTWPNRKHVVSCAAVCRAWREMCREIVLSPEFCGKLTFP
gm041219_Glyma1 RWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSWRNMCKDIVKSPEFCGKLTFP
Os021774_Os05t0 RWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEIVLSPEFCGKLTFP
pp034735_Pp1s15 CWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSWREITKELVRTPEQSGRLTFP
                 **.:*. ** *:::::: ** :** **.** ** **  ** : :::* :** .*::***

AT1G43640.1     VSLKQPGPRDGIIQCYIKRDKSNMTYHLYLSLSPAI---LVESGKFLLSAKRSRRATYTE
Sm012016_Selmo1 ISLKQPGPRDATMQCFIKRDRATSTYHLCLGLSPNFDAGLQEHGKFLLAARKVRRATTTD
pt039357_POPTR_ VSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPAL---LVENGKFLLSAKRKRRTACTE
Sb032660_Sorbi1 VSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAV---LMENGKFLLSAKRNRKTTCTE
gm041219_Glyma1 VSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPAL---LVENGKFLLSAKRTRRTTYTE
Os021774_Os05t0 LSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAV---LADSGKFLLSAKRHRKTTCTE
pp034735_Pp1s15 IALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPS----LVENGKFLLAARKFRRAASTD
                ::*****.*:. :**:****::. **:* * *..     * : *****:*:: *::: *:

AT1G43640.1     YVISMDADNISRSSSTYIGKLKSNFLGTKFIVYDTAPAYNSSQILSPP--NRSRSFNSKK
Sm012016_Selmo1 YIISLDPEDFSRGSTSYVGKLRSNFLGTKFTIYDSQPPHVGAMPSNS---RVGRRFGSKQ
pt039357_POPTR_ YVISMDADNVSRSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLAPPG---RSRRFYSKK
Sb032660_Sorbi1 YVISMDAENISRSSSTYIGKLRSNFLGTKFMISDTQPPYNGAVVPHAG--RTSRRFNSKK
gm041219_Glyma1 YVISMDADNISRSSNTYIGKLRSNFLGTKFIIYDTQPPYSSAHICPPGTGKTSRRFYSKK
Os021774_Os05t0 YVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPPVG--RSSRRFNSKK
pp034735_Pp1s15 YIISLNQEDISRGSNTYVGKLRSNFLGTKFTIYDSQPSHNGVAASN----RGAWRMGTKQ
                *:**:: ::.**.*.:*:***:******** : *: *.: .           .  : :*:

AT1G43640.1     VSPKVPSGSYNIAQVTYELNLLGTRGPRRMNCIMHSIPSLALEPGGTVPSQPE-FLQRSL
Sm012016_Selmo1 ISPRVPSGSYNVAHIAYELNVLGTRGPRRMQVTIHSIPASAMDPGGVAPTPT--VFANPL
pt039357_POPTR_ VSPKVPTGSYNIAQVTYELNVLGTRGPRRMHCTMHSIPALSLEPGGSVPGQPE-LLPRCL
Sb032660_Sorbi1 VSPKVPTGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASAVEPGGIVPGQPEQILPRAL
gm041219_Glyma1 VSPKVPSGSYNIAQVTYELNVLGTRGPRKMHCVMHSIPASALDAGGTVPGQPE-LLPRSL
Os021774_Os05t0 VSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSVEPGGIVPGQPEQIVPRAF
pp034735_Pp1s15 LSSRVHSGSYNVAHIAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTE-LAAGSL
                :*.:: :****:*:::****:*******:*:  :****: :::.** .*  .  .    :

AT1G43640.1     DE------SFRS-IGSSKI--VNHSGDFTRP------------------KEEEG--KVRP
Sm012016_Selmo1 EDAQLPF-------PVSKSKVSDCSTAPVVV------PYSGVMS------------KDGP
pt039357_POPTR_ ED------SFRS-ISFSKS--IDNSTEFSSS------RFSDIVG--PREEDEEG--KERP
Sb032660_Sorbi1 EE------SFRSTTSFSKSSIMDRSMDFSSSRDFSSARFSDIAGGAAIAGDEEGQNKERP
gm041219_Glyma1 ED------SFRS-ISFSKS--LDHSIEFSSS------RFSEIGE--SCIEDDDG--KMRP
Os021774_Os05t0 EE------SFRSTTSFSKSSIMDRSMDFSSSRDFSSARFSDIAGG-TINGDEEGQNKERP
pp034735_Pp1s15 EEVHVPYSSIMS-SPRSKAAVVDSSALESSE------FVSGLLN------------KEEP
                ::              **    : *                               *  *

AT1G43640.1     LVLKTKPPRWLQPLRCWCLNFKGRVTVASVKNFQLMSAATV--QPGSGSDGGALATRPSL
Sm012016_Selmo1 LVLKNKAPRWHDQLQCWCLNFRGRVTVASVKNFQLVAALE---------P----------
pt039357_POPTR_ LVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAT----QPAAGAP----------
Sb032660_Sorbi1 LVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLIAAPSPAPAPAARAP----------
gm041219_Glyma1 LVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAT----QPAAGAP----------
Os021774_Os05t0 LVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLIAAPA---QPPAGAP----------
pp034735_Pp1s15 LVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAATSVK-AVSAAAT----------
                ***:.*.*** : *:******:****:********::*                      

AT1G43640.1     SP-QQPEQSNHDKIILHFGKVGKDMFTMDYRYPLSAFQAFAISLSTFDTKLACE
Sm012016_Selmo1 ---GQQAHADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFGICLSSFDTKLACE
pt039357_POPTR_ TP-SQPAQSDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Sb032660_Sorbi1 TPSSQPVPQDQDKIILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm041219_Glyma1 TP-SQPAPPEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os021774_Os05t0 TP-SQPAPPEQDKIILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp034735_Pp1s15 ---TSSSSADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
                    .    ::**::*:***:.******************.*.**:********


BoxShade v3.31 C (beta, 970507) Output
AT1G43640.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Sm012016_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S S S S S S L L P L
pt039357_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Sb032660_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - L A K M S F
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os021774_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pp034735_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R - - S G S S M M P L
 
AT1G43640.1     L S I V R - - - D V R D T V G S F S R R S F D V R V S N - - G T T - H Q R S K S H G V E A H - - - I E D L - I V I K N T
Sm012016_Selmo1    R S I L R E F Q D I R D G I G S L S R R S F E V R L P Y - - - - - - H H R S R S H S V V L D E P P V R D V - V V L Q Q S
pt039357_POPTR_    R S I V R - - - D M R D G F G S L S R R S F E V R L P G - - - - - - H L R G K S H G S A C E - - - L Q D Q P V V I Q N S
Sb032660_Sorbi1    R S I V R - - - D V R D S F G S L S R R S F E V T I A G L S G L T V H H R G K S Q S T V H E - - - V C D T D L I I Q E S
gm041219_Glyma1    R S I V R - - - D V R D S F G S L S R R S F D V R L T G - - - - - - H H R G K S Q G S V Q D - - - L H D Q P L V I Q N S
Os021774_Os05t0    R S I V R - - - D V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V H E - - - L C D A D L I I Q E S
pp034735_Pp1s15    K S L I R E F Q E M K G G R G G I S R R S F E L K F P H - - - - - - H H K G R S S G M V L D E S Q L R V E - A V V K Q S
 
AT1G43640.1     R W A N L P A A L L R D V M K K L D E S E S T W P A R K Q V V A C A G V C K T W R L M C K D I V K S P E F S G K L T F P
Sm012016_Selmo1    R W A S M P P E L L R D V I Q R L E S S E H T W P A R K N V V V C A E V C S Q W R D I A K E L V K T P E Q S G K L T F P
pt039357_POPTR_    R W A G L P P E L L Q D V I K R L E A S E S T W P S R K H V V A C A S V C R A W R E M C K E I V R S P E F S G K I T F P
Sb032660_Sorbi1    R W A N L P P E L L R D V I R R L E A S E S T W P N R K H V V S C A A V C R A W R E M C R E I V L S P E F C G K L T F P
gm041219_Glyma1    R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W R N M C K D I V K S P E F C G K L T F P
Os021774_Os05t0    R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C K E I V L S P E F C G K L T F P
pp034735_Pp1s15    C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T F P
 
AT1G43640.1     V S L K Q P G P R D G I I Q C Y I K R D K S N M T Y H L Y L S L S P A I - - - L V E S G K F L L S A K R S R R A T Y T E
Sm012016_Selmo1    I S L K Q P G P R D A T M Q C F I K R D R A T S T Y H L C L G L S P N F D A G L Q E H G K F L L A A R K V R R A T T T D
pt039357_POPTR_    V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L V E N G K F L L S A K R K R R T A C T E
Sb032660_Sorbi1    V S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V - - - L M E N G K F L L S A K R N R K T T C T E
gm041219_Glyma1    V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A L - - - L V E N G K F L L S A K R T R R T T Y T E
Os021774_Os05t0    L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V - - - L A D S G K F L L S A K R H R K T T C T E
pp034735_Pp1s15    I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S - - - - L V E N G K F L L A A R K F R R A A S T D
 
AT1G43640.1     Y V I S M D A D N I S R S S S T Y I G K L K S N F L G T K F I V Y D T A P A Y N S S Q I L S P P - - N R S R S F N S K K
Sm012016_Selmo1    Y I I S L D P E D F S R G S T S Y V G K L R S N F L G T K F T I Y D S Q P P H V G A M P S N S - - - R V G R R F G S K Q
pt039357_POPTR_    Y V I S M D A D N V S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R R F Y S K K
Sb032660_Sorbi1    Y V I S M D A E N I S R S S S T Y I G K L R S N F L G T K F M I S D T Q P P Y N G A V V P H A G - - R T S R R F N S K K
gm041219_Glyma1    Y V I S M D A D N I S R S S N T Y I G K L R S N F L G T K F I I Y D T Q P P Y S S A H I C P P G T G K T S R R F Y S K K
Os021774_Os05t0    Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R S S R R F N S K K
pp034735_Pp1s15    Y I I S L N Q E D I S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N - - - - R G A W R M G T K Q
 
AT1G43640.1     V S P K V P S G S Y N I A Q V T Y E L N L L G T R G P R R M N C I M H S I P S L A L E P G G T V P S Q P E - F L Q R S L
Sm012016_Selmo1    I S P R V P S G S Y N V A H I A Y E L N V L G T R G P R R M Q V T I H S I P A S A M D P G G V A P T P T - - V F A N P L
pt039357_POPTR_    V S P K V P T G S Y N I A Q V T Y E L N V L G T R G P R R M H C T M H S I P A L S L E P G G S V P G Q P E - L L P R C L
Sb032660_Sorbi1    V S P K V P T G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S A V E P G G I V P G Q P E Q I L P R A L
gm041219_Glyma1    V S P K V P S G S Y N I A Q V T Y E L N V L G T R G P R K M H C V M H S I P A S A L D A G G T V P G Q P E - L L P R S L
Os021774_Os05t0    V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V E P G G I V P G Q P E Q I V P R A F
pp034735_Pp1s15    L S S R V H S G S Y N V A H I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E - L A A G S L
 
AT1G43640.1     D E - - - - - - S F R S - I G S S K I - - V N H S G D F T R P - - - - - - - - - - - - - - - - - - K E E E G - - K V R P
Sm012016_Selmo1    E D A Q L P F - - - - - - - P V S K S K V S D C S T A P V V V - - - - - - P Y S G V M S - - - - - - - - - - - - K D G P
pt039357_POPTR_    E D - - - - - - S F R S - I S F S K S - - I D N S T E F S S S - - - - - - R F S D I V G - - P R E E D E E G - - K E R P
Sb032660_Sorbi1    E E - - - - - - S F R S T T S F S K S S I M D R S M D F S S S R D F S S A R F S D I A G G A A I A G D E E G Q N K E R P
gm041219_Glyma1    E D - - - - - - S F R S - I S F S K S - - L D H S I E F S S S - - - - - - R F S E I G E - - S C I E D D D G - - K M R P
Os021774_Os05t0    E E - - - - - - S F R S T T S F S K S S I M D R S M D F S S S R D F S S A R F S D I A G G - T I N G D E E G Q N K E R P
pp034735_Pp1s15    E E V H V P Y S S I M S - S P R S K A A V V D S S A L E S S E - - - - - - F V S G L L N - - - - - - - - - - - - K E E P
 
AT1G43640.1     L V L K T K P P R W L Q P L R C W C L N F K G R V T V A S V K N F Q L M S A A T V - - Q P G S G S D G G A L A T R P S L
Sm012016_Selmo1    L V L K N K A P R W H D Q L Q C W C L N F R G R V T V A S V K N F Q L V A A L E - - - - - - - - - P - - - - - - - - - -
pt039357_POPTR_    L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T - - - - Q P A A G A P - - - - - - - - - -
Sb032660_Sorbi1    L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V K N F Q L I A A P S P A P A P A A R A P - - - - - - - - - -
gm041219_Glyma1    L V L K N K P P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T - - - - Q P A A G A P - - - - - - - - - -
Os021774_Os05t0    L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V K N F Q L I A A P A - - - Q P P A G A P - - - - - - - - - -
pp034735_Pp1s15    L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A T S V K - A V S A A A T - - - - - - - - - -
 
AT1G43640.1     S P - Q Q P E Q S N H D K I I L H F G K V G K D M F T M D Y R Y P L S A F Q A F A I S L S T F D T K L A C E
Sm012016_Selmo1    - - - G Q Q A H A D H D K V L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F G I C L S S F D T K L A C E
pt039357_POPTR_    T P - S Q P A Q S D H D K I I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Sb032660_Sorbi1    T P S S Q P V P Q D Q D K I I L Q F G K V A K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm041219_Glyma1    T P - S Q P A P P E H D K I I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os021774_Os05t0    T P - S Q P A P P E Q D K I I L Q F G K V A K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp034735_Pp1s15    - - - T S S S S A D H D K V L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
 
0