fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G43640.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os021774 not found in 445aa AT1G25280.1 1st_not 0.628536285 II
Os021773 not found in 445aa AT1G25280.1 not_not 0.628536285 III
Os019651 not found in 462aa AT1G25280.1 not_not 0.624846248 III
Os019649 not found in 462aa AT1G25280.1 not_not 0.624846248 III
Os029803 not found in 451aa AT1G25280.1 not_not 0.594095940 III
Os040209 not found in 445aa AT1G25280.1 not_not 0.594095940 III
Os004869 not found in 448aa AT1G25280.1 not_not 0.562115621 III
Os029490 not found in 406aa AT2G47900.2 not_not 0.467404674 III
Os029491 not found in 406aa AT2G47900.2 not_not 0.467404674 III
Os009468 not found in 428aa AT2G18280.2 not_not 0.453874538 III
Os009471 not found in 416aa AT2G18280.2 not_not 0.453874538 III
Os037720 not found in 317aa AT1G25280.1 not_not 0.408364083 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G43640.1     MSFLSIVRD---VRDTVGSFSRRSFDVRVS---NGTTHQRSKSHGVEAHIED--------
Os029490_Os07t0 MSFRSVIQE---VKGEIGAISRRGFRSR-------PGRVRRVAAAAEEPPDESSA-----
Os009471_Os02t0 ------------MRDGIGSMSRRAADGRAG---GGRGGSRHSWPVLWSEQQQPPQQQQLQ
Os021773_Os05t0 MSFRSIVRD---VRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTVHELCDADL-----
Os037720_Os11t0 ------------------------------------------------------------
Os029491_Os07t0 MSFRSVIQE---VKGEIGAISRRGFRSR-------PGRVRRVAAAAEEPPDESSA-----
Os040209_Os12t0 MSFRSIVRD---VRDGFGSLSRRGFEVRLV------GHRRGRSHSAVHELRDGHAA---A
Os021774_Os05t0 MSFRSIVRD---VRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTVHELCDADL-----
Os004869_Os01t0 MSFRSIVRD---VRDGFGSLSRRSFEVTLASLYGLTGHHKGKTQSSLDELDDSPA-----
Os029803_Os08t0 MSFRSIVRD---VRDSFGSLSRRSFEVRISGLPGLSGHHRGKSLGSLSELRDRPV-----
Os019649_Os04t0 MSFRSIVRD---FRDSFGTLSKRSFEVKIS---GFSGRHRGKSIGPSSELDDTPV-----
Os019651_Os04t0 MSFRSIVRD---FRDSFGTLSKRSFEVKIS---GFSGRHRGKSIGPSSELDDTPV-----
Os009468_Os02t0 MSLKSIVRELREMRDGIGSMSRRAADGRAG---GGRGGSRHSWPVLWSEQQQPPQQQQLQ
                                                                            

AT1G43640.1     --LIVIKNTRWANLPAALLRDVMKKLDESESTWPARKQVVACAGVCKTWRLMCKDIVKSP
Os029490_Os07t0 -AALVMRESCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIVREIVRTP
Os009471_Os02t0 RQEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVTKEVVKTL
Os021773_Os05t0 ----IIQESRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEIVLSP
Os037720_Os11t0 ------------------------------------------------------------
Os029491_Os07t0 -AALVMRESCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIVREIVRTP
Os040209_Os12t0 AAADVVQSSCWANLPPELLRDVIERLEASEAAWPSRKNVVACAAVCRTWRDMCREIVKNP
Os021774_Os05t0 ----IIQESRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEIVLSP
Os004869_Os01t0 ----IIPESRWASLPPELLREVIRRLEADESTWPSRRNVVCFAAVCRTWREMCKETVLSP
Os029803_Os08t0 ----VVDQSRWVGLPPELLRDVMKRLEEGESNWPSRKDVVACAAVCRTWREICKDIVQSP
Os019649_Os04t0 ----VAQQSKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTWRDMCKDIVRNP
Os019651_Os04t0 ----VAQQSKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTWRDMCKDIVRNP
Os009468_Os02t0 RQEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVTKEVVKTL
                                                                            

AT1G43640.1     EFSGKLTFPVSLKQPGPRDGIIQCYIKRDKSNMTYHLYLSLSPAILVESGKFLLSAKRSR
Os029490_Os07t0 EASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKFLLAARKCR
Os009471_Os02t0 EECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAARKIR
Os021773_Os05t0 EFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFLLSAKRHR
Os037720_Os11t0 ---------------------MQCFIRRDKSTQTYYLYLSLGSAVLVDNGKFLLSAKRNW
Os029491_Os07t0 EASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKFLLAARKCR
Os040209_Os12t0 EFCGKITFPVSLKQPGPRNGAIQCFIKRDKSTQTYNLYLCLSSAVLVESGKFLLSAKRYS
Os021774_Os05t0 EFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFLLSAKRHR
Os004869_Os01t0 EFCGKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNVVTAEGGKFVLAAKRHR
Os029803_Os08t0 EICGKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPAVLSENGKFLLAAKRNR
Os019649_Os04t0 EFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKFLLSAKRSR
Os019651_Os04t0 EFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKFLLSAKRSR
Os009468_Os02t0 EECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAARKIR
                                     ::*:: *:::. ** **: *      : .*::*:*::  

AT1G43640.1     RATYTEYVISMDADNISRSSSTYIGKLKSNFLGTKFIVYDTAPAYNSSQILSPPNRSRSF
Os029490_Os07t0 RTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPY-AGDVISKGQSARVI
Os009471_Os02t0 RATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPNNRPSKRHF
Os021773_Os05t0 KTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPPVGRSSRRF
Os037720_Os11t0 HATCTEYVISMNANNLSRSTNTNIGKLRSNFLGTKFVIYDTHTPYNATSDSQSGKTSRRF
Os029491_Os07t0 RTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPY-AGDVISKGQSARVI
Os040209_Os12t0 RATCTEYTIFMSADNTSRSSNMYIGKLRSNLLGTKFVIYDTQPPCNTANVSQSGKTSRRF
Os021774_Os05t0 KTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPPVGRSSRRF
Os004869_Os01t0 KTTCTEYTISMVSGNISRSSRTNIGKLRSNFLGTKFIIYDTQPPYNGAVVPHVGRTSKRF
Os029803_Os08t0 RATSTEYIISVDSKNISRSSNGYVGKMRSNFLGTKFVVYDTQPPYNAGSLMSCQHGSRRI
Os019649_Os04t0 RTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCSQERTSRRF
Os019651_Os04t0 RTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCSQERTSRRF
Os009468_Os02t0 RATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPNNRPSKRHF
                ::* *.: * :   : *  :   :**::.*:***** ::*: ..             : :

AT1G43640.1     NSKKVSPKVPSGSYNIAQVTYELNLLGTRGPRRMNCIMHSIPSLALEPGGTVPSQPE-FL
Os029490_Os07t0 GSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAIEQGGTAPTQTE--F
Os009471_Os02t0 --KQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCIQEGGKAPTPTG--I
Os021773_Os05t0 NSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSVEPGGIVPGQPEQIV
Os037720_Os11t0 -SNKGTAKHPCSTYSIANISYELNVFGTRGPRRMCCLMHSIPASSLEAGGTVPSQPDSIL
Os029491_Os07t0 GSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAIEQGGTAPTQTE--F
Os040209_Os12t0 YSRKVSPKNPSSTYSIAQVSYELNVLGTRGPRRMNCVMHSIPASSLEAGGTVPCQPDSVL
Os021774_Os05t0 NSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSVEPGGIVPGQPEQIV
Os004869_Os01t0 NSTKVSPKVPSVTYNIAQVSYELNVLGTRGPRRMRCMMHSIPASSVEPGGIVPGQPEQIV
Os029803_Os08t0 SSRRVSPKLPTGSYPIAHVKYELNVLGTRGPRRMQCTMHSIPASAVDPEGVVPGQPEQLL
Os019649_Os04t0 SSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAVEPGGIVPGQPKELL
Os019651_Os04t0 SSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAVEPGGIVPGQPKELL
Os009468_Os02t0 --KQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCIQEGGKAPTPTG--I
                   : :.: *   * :  :.***.:: .****** * *.***  .::  * .*  .   .

AT1G43640.1     QRSLDE-SFRSIGSS-------------KIVNHSG------DFTRPK-------------
Os029490_Os07t0 PLSYHE-SFTSI--PFFKS--------KSV-----------RANNSTAS-LLTQN-GSK-
Os009471_Os02t0 IHSLDE-QVPALSTSKGKE--------PAI-----------EFSSTSLSADLS---GPV-
Os021773_Os05t0 PRAFEE-SFRST-TSFSKS---------SIMDRSMDFSSSRDFSSARFS-DIA---GGT-
Os037720_Os11t0 AHSLNESSFRSV--SFSKS---------SVMDHSM------HFSSAQFS-DISIGDGPRI
Os029491_Os07t0 PLSYHE-SFTSI--PFFKS--------KSV-----------RANNSTAS-LLTQN-GSK-
Os040209_Os12t0 ARSLDE-SFGSI--SFSKS---------SIMDRSI------RFSSSRYS-DISVG-GPMV
Os021774_Os05t0 PRAFEE-SFRST-TSFSKS---------SIMDRSMDFSSSRDFSSARFS-DIA---GGT-
Os004869_Os01t0 PRALED-SFRST-TSFSQSFRSTTSFSKSIMDPSM------DFSSARFS-DIS---GSI-
Os029803_Os08t0 PGPFEE-SFRSTNTS-SRF---------SFMDRSL------DFSSSRFS-EIS---GSAN
Os019649_Os04t0 PRLFEE-SFRSMATSFSKY---------SITDHST------DFSSSRFS-EFG---GGAL
Os019651_Os04t0 PRLFEE-SFRSMATSFSKY---------SITDHST------DFSSSRFS-EFG---GGAL
Os009468_Os02t0 IHSLDE-QVPALSTSKGKE--------PAI-----------EFSSTSLSADLS---GPV-
                    .: .. :   .              .             . .              

AT1G43640.1     ----------EE-EGKVRPLVLKTKPPRWLQPLRCWCLNFKGRVTVASVKNFQLMSAATV
Os029490_Os07t0 -------------------LVLKNKSPRWHEHLQCWCLNFHGRVTVASVKNFQLVASD--
Os009471_Os02t0 -------------CTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASV--
Os021773_Os05t0 ------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLIAAPA-
Os037720_Os11t0 GGR---VLSDDE-ECKETPLILQNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAT--
Os029491_Os07t0 -------------------LVLKNKSPRWHEHLQCWCLNFHGRVTVASVKNFQLVASD--
Os040209_Os12t0 GGQ---ALGDSD-ESKERPLILRNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAT--
Os021774_Os05t0 ------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLIAAPA-
Os004869_Os01t0 ------MGGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIASVKNFQLVAAPS-
Os029803_Os08t0 Q-----QGEDDIPEAKERPLVLRNKVPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAA--
Os019649_Os04t0 QGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAAP-
Os019651_Os04t0 QGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAAAP-
Os009468_Os02t0 -------------CTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVASV--
                                   *:*:.* *** : *:******:****:********:::   

AT1G43640.1     QPGSGSDGGALATRPSLSPQQPEQ----------------SNHDKIILHFGKVGKDMFTM
Os029490_Os07t0 -----------ESNPT-----------------------NQEHDDVILQFGKVGKDMFTM
Os009471_Os02t0 DPSLGI--------PA------------------------AEQEKVILQFGKIGKDIFTM
Os021773_Os05t0 QPPAGA-----PT-PS-QPAPPEQ-------------------DKIILQFGKVAKDMFTM
Os037720_Os11t0 QPAAGA-----PT-PS-QPVPPPP----------------PEHDKVILQFGKVAKDMFTM
Os029491_Os07t0 -----------ESNPT-----------------------NQEHDDVILQFGKVGKDMFTM
Os040209_Os12t0 QPAAGA-----PT-PS-QPAPPPP----------------PDHDKVILQFGKVAKDMFTM
Os021774_Os05t0 QPPAGA-----PT-PS-QPAPPEQ-------------------DKIILQFGKVAKDMFTM
Os004869_Os01t0 PPPAGA-----PT-PS-QPGPADP-------------------EKVILQFGKVARDMFTM
Os029803_Os08t0 --------------SS-ESSQLEQQQQQQQQNHASSSSSASDHGKVILQFGKVGKDMFTM
Os019649_Os04t0 QPSSGA-----ASEPS-QAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAKDMFTM
Os019651_Os04t0 QPSSGA-----ASEPS-QAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAKDMFTM
Os009468_Os02t0 DPSLGI--------PA------------------------AEQEKVILQFGKIGKDIFTM
                              .:                             :**:***:.:*:***

AT1G43640.1     DYRYPLSAFQAFAISLSTFDTKLACE
Os029490_Os07t0 DYRYPISAFQAFAICLSSFDTKIACE
Os009471_Os02t0 DYRYPLSAFQAFAICLTSFDTKPACE
Os021773_Os05t0 DYRYPLSAFQAFAICLSSFDTKLACE
Os037720_Os11t0 DYHYPLSAFQAFAISLSSFDTKLACE
Os029491_Os07t0 DYRYPISAFQAFAICLSSFDTKIACE
Os040209_Os12t0 DYRYPLSAFQAFAICLSSFDTKLACE
Os021774_Os05t0 DYRYPLSAFQAFAICLSSFDTKLACE
Os004869_Os01t0 DYRYPLSAFQAFAICLSSFDTKLACE
Os029803_Os08t0 DYRYPLSAFQAFAICLTSFDTKLACE
Os019649_Os04t0 DYRYPLSAFQAFAICLTSFDTKLACE
Os019651_Os04t0 DYRYPLSAFQAFAICLTSFDTKLACE
Os009468_Os02t0 DYRYPLSAFQAFAICLTSFDTKPACE
                **:**:********.*::**** ***


BoxShade v3.31 C (beta, 970507) Output
AT1G43640.1     M S F L S I V R D - - - V R D T V G S F S R R S F D V R V S - - - N G T T H Q R S K S H G V E A H I E D - - - - - - - -
Os029490_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F R S R - - - - - - - P G R V R R V A A A A E E P P D E S S A - - - - -
Os009471_Os02t0    - - - - - - - - - - - - M R D G I G S M S R R A A D G R A G - - - G G R G G S R H S W P V L W S E Q Q Q P P Q Q Q Q L Q
Os021773_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V H E L C D A D L - - - - -
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029491_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F R S R - - - - - - - P G R V R R V A A A A E E P P D E S S A - - - - -
Os040209_Os12t0    M S F R S I V R D - - - V R D G F G S L S R R G F E V R L V - - - - - - G H R R G R S H S A V H E L R D G H A A - - - A
Os021774_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V H E L C D A D L - - - - -
Os004869_Os01t0    M S F R S I V R D - - - V R D G F G S L S R R S F E V T L A S L Y G L T G H H K G K T Q S S L D E L D D S P A - - - - -
Os029803_Os08t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V R I S G L P G L S G H H R G K S L G S L S E L R D R P V - - - - -
Os019649_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F E V K I S - - - G F S G R H R G K S I G P S S E L D D T P V - - - - -
Os019651_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F E V K I S - - - G F S G R H R G K S I G P S S E L D D T P V - - - - -
Os009468_Os02t0    M S L K S I V R E L R E M R D G I G S M S R R A A D G R A G - - - G G R G G S R H S W P V L W S E Q Q Q P P Q Q Q Q L Q
 
AT1G43640.1     - - L I V I K N T R W A N L P A A L L R D V M K K L D E S E S T W P A R K Q V V A C A G V C K T W R L M C K D I V K S P
Os029490_Os07t0    - A A L V M R E S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W R G I V R E I V R T P
Os009471_Os02t0    R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T K E V V K T L
Os021773_Os05t0    - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C K E I V L S P
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029491_Os07t0    - A A L V M R E S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W R G I V R E I V R T P
Os040209_Os12t0    A A A D V V Q S S C W A N L P P E L L R D V I E R L E A S E A A W P S R K N V V A C A A V C R T W R D M C R E I V K N P
Os021774_Os05t0    - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C K E I V L S P
Os004869_Os01t0    - - - - I I P E S R W A S L P P E L L R E V I R R L E A D E S T W P S R R N V V C F A A V C R T W R E M C K E T V L S P
Os029803_Os08t0    - - - - V V D Q S R W V G L P P E L L R D V M K R L E E G E S N W P S R K D V V A C A A V C R T W R E I C K D I V Q S P
Os019649_Os04t0    - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W R D M C K D I V R N P
Os019651_Os04t0    - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W R D M C K D I V R N P
Os009468_Os02t0    R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T K E V V K T L
 
AT1G43640.1     E F S G K L T F P V S L K Q P G P R D G I I Q C Y I K R D K S N M T Y H L Y L S L S P A I L V E S G K F L L S A K R S R
Os029490_Os07t0    E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F L L A A R K C R
Os009471_Os02t0    E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L L L A A R K I R
Os021773_Os05t0    E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F L L S A K R H R
Os037720_Os11t0    - - - - - - - - - - - - - - - - - - - - - M Q C F I R R D K S T Q T Y Y L Y L S L G S A V L V D N G K F L L S A K R N W
Os029491_Os07t0    E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F L L A A R K C R
Os040209_Os12t0    E F C G K I T F P V S L K Q P G P R N G A I Q C F I K R D K S T Q T Y N L Y L C L S S A V L V E S G K F L L S A K R Y S
Os021774_Os05t0    E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F L L S A K R H R
Os004869_Os01t0    E F C G K L T F P V S I K Q P G P R D G M I Q C Y I K R N R S K S T Y H L Y L C L S N V V T A E G G K F V L A A K R H R
Os029803_Os08t0    E I C G K L T F P V S L K Q P G P R D G L I Q C F I K R D K S K L T Y Y L Y L C L S P A V L S E N G K F L L A A K R N R
Os019649_Os04t0    E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F L L S A K R S R
Os019651_Os04t0    E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F L L S A K R S R
Os009468_Os02t0    E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L L L A A R K I R
 
AT1G43640.1     R A T Y T E Y V I S M D A D N I S R S S S T Y I G K L K S N F L G T K F I V Y D T A P A Y N S S Q I L S P P N R S R S F
Os029490_Os07t0    R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y - A G D V I S K G Q S A R V I
Os009471_Os02t0    R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N N R P S K R H F
Os021773_Os05t0    K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G R S S R R F
Os037720_Os11t0    H A T C T E Y V I S M N A N N L S R S T N T N I G K L R S N F L G T K F V I Y D T H T P Y N A T S D S Q S G K T S R R F
Os029491_Os07t0    R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y - A G D V I S K G Q S A R V I
Os040209_Os12t0    R A T C T E Y T I F M S A D N T S R S S N M Y I G K L R S N L L G T K F V I Y D T Q P P C N T A N V S Q S G K T S R R F
Os021774_Os05t0    K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G R S S R R F
Os004869_Os01t0    K T T C T E Y T I S M V S G N I S R S S R T N I G K L R S N F L G T K F I I Y D T Q P P Y N G A V V P H V G R T S K R F
Os029803_Os08t0    R A T S T E Y I I S V D S K N I S R S S N G Y V G K M R S N F L G T K F V V Y D T Q P P Y N A G S L M S C Q H G S R R I
Os019649_Os04t0    R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E R T S R R F
Os019651_Os04t0    R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E R T S R R F
Os009468_Os02t0    R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N N R P S K R H F
 
AT1G43640.1     N S K K V S P K V P S G S Y N I A Q V T Y E L N L L G T R G P R R M N C I M H S I P S L A L E P G G T V P S Q P E - F L
Os029490_Os07t0    G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I E Q G G T A P T Q T E - - F
Os009471_Os02t0    - - K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I Q E G G K A P T P T G - - I
Os021773_Os05t0    N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V E P G G I V P G Q P E Q I V
Os037720_Os11t0    - S N K G T A K H P C S T Y S I A N I S Y E L N V F G T R G P R R M C C L M H S I P A S S L E A G G T V P S Q P D S I L
Os029491_Os07t0    G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I E Q G G T A P T Q T E - - F
Os040209_Os12t0    Y S R K V S P K N P S S T Y S I A Q V S Y E L N V L G T R G P R R M N C V M H S I P A S S L E A G G T V P C Q P D S V L
Os021774_Os05t0    N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V E P G G I V P G Q P E Q I V
Os004869_Os01t0    N S T K V S P K V P S V T Y N I A Q V S Y E L N V L G T R G P R R M R C M M H S I P A S S V E P G G I V P G Q P E Q I V
Os029803_Os08t0    S S R R V S P K L P T G S Y P I A H V K Y E L N V L G T R G P R R M Q C T M H S I P A S A V D P E G V V P G Q P E Q L L
Os019649_Os04t0    S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V E P G G I V P G Q P K E L L
Os019651_Os04t0    S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V E P G G I V P G Q P K E L L
Os009468_Os02t0    - - K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I Q E G G K A P T P T G - - I
 
AT1G43640.1     Q R S L D E - S F R S I G S S - - - - - - - - - - - - - K I V N H S G - - - - - - D F T R P K - - - - - - - - - - - - -
Os029490_Os07t0    P L S Y H E - S F T S I - - P F F K S - - - - - - - - K S V - - - - - - - - - - - R A N N S T A S - L L T Q N - G S K -
Os009471_Os02t0    I H S L D E - Q V P A L S T S K G K E - - - - - - - - P A I - - - - - - - - - - - E F S S T S L S A D L S - - - G P V -
Os021773_Os05t0    P R A F E E - S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A R F S - D I A - - - G G T -
Os037720_Os11t0    A H S L N E S S F R S V - - S F S K S - - - - - - - - - S V M D H S M - - - - - - H F S S A Q F S - D I S I G D G P R I
Os029491_Os07t0    P L S Y H E - S F T S I - - P F F K S - - - - - - - - K S V - - - - - - - - - - - R A N N S T A S - L L T Q N - G S K -
Os040209_Os12t0    A R S L D E - S F G S I - - S F S K S - - - - - - - - - S I M D R S I - - - - - - R F S S S R Y S - D I S V G - G P M V
Os021774_Os05t0    P R A F E E - S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A R F S - D I A - - - G G T -
Os004869_Os01t0    P R A L E D - S F R S T - T S F S Q S F R S T T S F S K S I M D P S M - - - - - - D F S S A R F S - D I S - - - G S I -
Os029803_Os08t0    P G P F E E - S F R S T N T S - S R F - - - - - - - - - S F M D R S L - - - - - - D F S S S R F S - E I S - - - G S A N
Os019649_Os04t0    P R L F E E - S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S R F S - E F G - - - G G A L
Os019651_Os04t0    P R L F E E - S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S R F S - E F G - - - G G A L
Os009468_Os02t0    I H S L D E - Q V P A L S T S K G K E - - - - - - - - P A I - - - - - - - - - - - E F S S T S L S A D L S - - - G P V -
 
AT1G43640.1     - - - - - - - - - - E E - E G K V R P L V L K T K P P R W L Q P L R C W C L N F K G R V T V A S V K N F Q L M S A A T V
Os029490_Os07t0    - - - - - - - - - - - - - - - - - - - L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A S D - -
Os009471_Os02t0    - - - - - - - - - - - - - C T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A S V - -
Os021773_Os05t0    - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V K N F Q L I A A P A -
Os037720_Os11t0    G G R - - - V L S D D E - E C K E T P L I L Q N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T - -
Os029491_Os07t0    - - - - - - - - - - - - - - - - - - - L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A S D - -
Os040209_Os12t0    G G Q - - - A L G D S D - E S K E R P L I L R N K A P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A T - -
Os021774_Os05t0    - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V K N F Q L I A A P A -
Os004869_Os01t0    - - - - - - M G G D D N G E I K E R P L V L R N K P P R W H E Q L Q C W C L N F R G R V T I A S V K N F Q L V A A P S -
Os029803_Os08t0    Q - - - - - Q G E D D I P E A K E R P L V L R N K V P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A A - -
Os019649_Os04t0    Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A A P -
Os019651_Os04t0    Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A A P -
Os009468_Os02t0    - - - - - - - - - - - - - C T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A S V - -
 
AT1G43640.1     Q P G S G S D G G A L A T R P S L S P Q Q P E Q - - - - - - - - - - - - - - - - S N H D K I I L H F G K V G K D M F T M
Os029490_Os07t0    - - - - - - - - - - - E S N P T - - - - - - - - - - - - - - - - - - - - - - - N Q E H D D V I L Q F G K V G K D M F T M
Os009471_Os02t0    D P S L G I - - - - - - - - P A - - - - - - - - - - - - - - - - - - - - - - - - A E Q E K V I L Q F G K I G K D I F T M
Os021773_Os05t0    Q P P A G A - - - - - P T - P S - Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F G K V A K D M F T M
Os037720_Os11t0    Q P A A G A - - - - - P T - P S - Q P V P P P P - - - - - - - - - - - - - - - - P E H D K V I L Q F G K V A K D M F T M
Os029491_Os07t0    - - - - - - - - - - - E S N P T - - - - - - - - - - - - - - - - - - - - - - - N Q E H D D V I L Q F G K V G K D M F T M
Os040209_Os12t0    Q P A A G A - - - - - P T - P S - Q P A P P P P - - - - - - - - - - - - - - - - P D H D K V I L Q F G K V A K D M F T M
Os021774_Os05t0    Q P P A G A - - - - - P T - P S - Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F G K V A K D M F T M
Os004869_Os01t0    P P P A G A - - - - - P T - P S - Q P G P A D P - - - - - - - - - - - - - - - - - - - E K V I L Q F G K V A R D M F T M
Os029803_Os08t0    - - - - - - - - - - - - - - S S - E S S Q L E Q Q Q Q Q Q Q Q N H A S S S S S A S D H G K V I L Q F G K V G K D M F T M
Os019649_Os04t0    Q P S S G A - - - - - A S E P S - Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F G K V A K D M F T M
Os019651_Os04t0    Q P S S G A - - - - - A S E P S - Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F G K V A K D M F T M
Os009468_Os02t0    D P S L G I - - - - - - - - P A - - - - - - - - - - - - - - - - - - - - - - - - A E Q E K V I L Q F G K I G K D I F T M
 
AT1G43640.1     D Y R Y P L S A F Q A F A I S L S T F D T K L A C E
Os029490_Os07t0    D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
Os009471_Os02t0    D Y R Y P L S A F Q A F A I C L T S F D T K P A C E
Os021773_Os05t0    D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os037720_Os11t0    D Y H Y P L S A F Q A F A I S L S S F D T K L A C E
Os029491_Os07t0    D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
Os040209_Os12t0    D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os021774_Os05t0    D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os004869_Os01t0    D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os029803_Os08t0    D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os019649_Os04t0    D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os019651_Os04t0    D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os009468_Os02t0    D Y R Y P L S A F Q A F A I C L T S F D T K P A C E
 
0