fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G47270.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Pp000633 not found in 474aa AT2G47900.2 1st_not 0.522179974 II
Pp034735 not found in 483aa AT2G47900.2 not_not 0.518377693 III
Pp034734 not found in 483aa AT2G47900.2 not_not 0.518377693 III
Pp022942 not found in 447aa AT2G47900.2 not_not 0.518377693 III
Pp005711 not found in 407aa AT2G47900.2 not_not 0.514575411 III
Pp034759 not found in 428aa AT2G47900.2 not_not 0.513307984 III
Pp022947 not found in 435aa AT2G47900.2 not_not 0.512040557 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G47270.1     ---------------MDL----------------------------------SLLLPKRS
pp022947_Pp1s22 ------------------------------------------------------------
pp034735_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRSGSSMMPLKS
pp034759_Pp1s15 -------------------------------------------------------MPLKS
pp005711_Pp1s21 ------------------------------------------------------------
pp000633_Pp1s10 MLASECLTVHGLRRWLKLWLILLKRSLEGIWCEVSRRELGFCKWTMSGQKS-SSMMPLKS
pp034734_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRSGSSMMPLKS
pp022942_Pp1s22 -------------------------------------------------------MPLKS
                                                                            

AT1G47270.1     W-----EISGGADKISRVAMSLKNIVKNKYKAIGRRGRSHIAPEGSSV-SSSLSTNEGLN
pp022947_Pp1s22 -------MKGGIGNISRRSFELKFPHHH-------KGRS----SGMVLDESQLRAEPVVE
pp034735_Pp1s15 LIREFQEMKGGRGGISRRSFELKFPHHH-------KGRS----SGMVLDESQLRVEAVVK
pp034759_Pp1s15 LIREFQEMKGGRGGISRRSFELKFPHHH-------KGRS----SGMVLDESQLRVEAVVK
pp005711_Pp1s21 -------MKSGVGRISRRSFELKFPHHH-------RGRS----SGMVLDESQLNSEPVVE
pp000633_Pp1s10 LIREFQEMKGGIGNISRRSFELKFPHHH-------RGRS----SGMVLDESQLRPERVVE
pp034734_Pp1s15 LIREFQEMKGGRGGISRRSFELKFPHHH-------KGRS----SGMVLDESQLRVEAVVK
pp022942_Pp1s22 LIREFQEMKGGIGNISRRSFELKFPHHH-------KGRS----SGMVLDESQLRAEPVVE
                       :..* . *** ::.**   ::       :***    .*  : .*.*  :  ::

AT1G47270.1     QSIWVDLPPELLLDIIQRIESEQSLWPGRRDVVACASVCKSWREMTKEVVKVPELSGLIT
pp022947_Pp1s22 QSCWANMPPELLRDVIQRVEASENAWPSRKHVVACAAVCSSWREITKELVRTPEQSGRLT
pp034735_Pp1s15 QSCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSWREITKELVRTPEQSGRLT
pp034759_Pp1s15 QSCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSWREITKELVRTPEQSGRLT
pp005711_Pp1s21 QSCWANMPPELLRDVIQRVEASESAWPSRKHVVACAAVCSSWREVTKELVRAPEQSGRLT
pp000633_Pp1s10 QSCWANMPPELLRDVIQRVEVSESTWPSRKHVVACAAVCSSWREITKELVRTPEQSGRLT
pp034734_Pp1s15 QSCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSWREITKELVRTPEQSGRLT
pp022942_Pp1s22 QSCWANMPPELLRDVIQRVEASENAWPSRKHVVACAAVCSSWREITKELVRTPEQSGRLT
                ** *.::***** *:***:* .:. **.*:.*****:**.****:***:*:.** ** :*

AT1G47270.1     FPISLRQPGPRDAPIQCFIKRERATGIYRLYLGLSPALSGDKSKLLLSAKRVRRATGAEF
pp022947_Pp1s22 FPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPSLV-ENGKFLLAARKFRRATSTDY
pp034735_Pp1s15 FPIALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPSLV-ENGKFLLAARKFRRAASTDY
pp034759_Pp1s15 FPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPTLV-ENGKFLLAAKKFRRPTRTDY
pp005711_Pp1s21 FPVALKQPGPREDTVQCFIKRDRTTSTYQLFLGLPPSQ--ENGKFLLAAQKFRRATSTDY
pp000633_Pp1s10 FPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPSLI-ENGKFLLAARKFRRATSTDY
pp034734_Pp1s15 FPIALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPSLV-ENGKFLLAARKFRRAASTDY
pp022942_Pp1s22 FPIALKQPGPRDSTMQCFIKRDRTTSTYQLFLGLPPSLV-ENGKFLLAARKCRRATSTDY
                **::*:*****: .:******:*::. *:*:***.*:   ::.*:**:*:: **.: :::

AT1G47270.1     VVSLSGNDFSRSSSNYIGKLRSNFLGTKFTVYENQPP-----PFNR--KLPPSMQVSPWV
pp022947_Pp1s22 IISLNQENMSRGSNTYVGKLRSNFLGTKFTIYDSQPPHSGVVASNRGTRRMGSKQLTSRV
pp034735_Pp1s15 IISLNQEDISRGSNTYVGKLRSNFLGTKFTIYDSQPSHNGVAASNRGAWRMGTKQLSSRV
pp034759_Pp1s15 IISLNHDDMSRGGTAYVGKLRSNFLGTKFTIYDSQPSHNGVAASNRGAWRMGTKQLSSRV
pp005711_Pp1s21 IISLNQEDMSRGSSTYVGKLRSNFLGTKFTIYDSQPPQNGPVLSNRSSRRLTSKQLSYRA
pp000633_Pp1s10 IISLNQEDMSRGSNTYVGKLRSNFLGTKFTIYDSQPPHNRGVASNRSSRRIGSKQLTSRV
pp034734_Pp1s15 IISLNQEDISRGSNTYVGKLRSNFLGTKFTIYDSQPSHNGVAASNRGAWRMGTKQLSSRV
pp022942_Pp1s22 IVSLNHEDMSRGSNTYVGKLRSNFLGTKFTIYDSQPPHSGVVASNRGTRRLGSKQLTSRV
                ::**. :::**... *:*************:*:.**.       **      : *::  .

AT1G47270.1     SSSSSSYNIASILYELNVLRTRGPRRMQCIMHSIPISAIQEGGKIQSPTEFTNQG-----
pp022947_Pp1s22 --HCGSYNVAHIAYELNVLGTRGPRRMQCTMHSIPASAMASGGSAPTPTEFTSCGLEEAH
pp034735_Pp1s15 --HSGSYNVAHIAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTELAAGSLEEVH
pp034759_Pp1s15 --HSGSYNVAHIAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTELAAGSLEEVH
pp005711_Pp1s21 --HAGSFNVAHIAYELNVLGTRGPRRMQCTLHGIPLSTMESVGSAPSPTEVTADSLERAH
pp000633_Pp1s10 --HAGSYNVAHIAYELNVLGTRGPRRMQCMLHTIPMSAMESGGSAPTPTEFTASTLEDTH
pp034734_Pp1s15 --HSGSYNVAHIAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTELAAGSLEEVH
pp022942_Pp1s22 --HCGSHNVAHIAYELNVLGTRGPRRMQCTMHSIPASAMASGGSAPTPTEFTSCGLEEAH
                   ..*.*:* * ****** ********* :* ** .:: . *.  :***.:        

AT1G47270.1     ---------KKKKKPLMD--------FCSGNLGGESVIKEPLILKNKSPRWHEQLQCWCL
pp022947_Pp1s22 VPYSSILLSPRSKAAVVDSSALESSELVSGVLCKE----EPLVLKNKAPRWHEQLQCWCL
pp034735_Pp1s15 VPYSSIMSSPRSKAAVVDSSALESSEFVSGLLNKE----EPLVLRNKAPRWHEQLQCWCL
pp034759_Pp1s15 VPYSSIMSSPRSKAAVVDSSALESSEFVSGLLNKE----EPLVLRNKAPRWHEQLQCWCL
pp005711_Pp1s21 VPHSGVMSSSRSKAAVVDISTLD-YDFASGLLAKD----EPLVLKNKAPRWHEQLQCWCL
pp000633_Pp1s10 VAYSGILSSPRSRAAVVDSSTLD-CDFVSGPLTKD----APLILKNKAPRWHEQLQCWCL
pp034734_Pp1s15 VPYSSIMSSPRSKAAVVDSSALESSEFVSGLLNKE----EPLVLRNKAPRWHEQLQCWCL
pp022942_Pp1s22 VPYSSILLSPRSKAAVVDSSALESSELVSGVLCKE----EPLVLKNKAPRWHEQLQCWCL
                          :.: .::*        : ** *  :     **:*:**:************

AT1G47270.1     NFKGRVTVASVKNFQLVAA----------AAEAGKNM-------------NIPEEEQDRV
pp022947_Pp1s22 NFRGRVTVASVKNFQLVAATTSSTTTSTTAGEAAAATGGGGGAGAATPAPTSSGSDHDKV
pp034735_Pp1s15 NFRGRVTVASVKNFQLVAA------TSVKAVSAAATT-------------SSSSADHDKV
pp034759_Pp1s15 NFRGRVTVASVKNFQLVAA------TSVKAVSAAATT-------------SSSSADHDKV
pp005711_Pp1s21 NFRGRVTVASVKNFQLVASMES--------------------------LPTSSQSDRDKV
pp000633_Pp1s10 NFRGRVTVASVKNFQLVAATDL--------------------------PPTNSQNDHDKV
pp034734_Pp1s15 NFRGRVTVASVKNFQLVAA------TSVKAVSAAATT-------------SSSSADHDKV
pp022942_Pp1s22 NFRGRVTVASVKNFQLVAATTSSTTTSTTAGEAAAATGGGGGAGAATPAPTSSGSDHDKV
                **:***************:                               . .  ::*:*

AT1G47270.1     ILQFGKIGKDIFTMDYRYPISAFQAFAICLSSFDTKPVCE
pp022947_Pp1s22 LLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp034735_Pp1s15 LLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp034759_Pp1s15 LLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp005711_Pp1s21 LLQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp000633_Pp1s10 LLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp034734_Pp1s15 LLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
pp022942_Pp1s22 LLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
                :*********:********:**************** .**


BoxShade v3.31 C (beta, 970507) Output
AT1G47270.1     - - - - - - - - - - - - - - - M D L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - S L L L P K R S
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034735_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S G S S M M P L K S
pp034759_Pp1s15    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P L K S
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp000633_Pp1s10    M L A S E C L T V H G L R R W L K L W L I L L K R S L E G I W C E V S R R E L G F C K W T M S G Q K S - S S M M P L K S
pp034734_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S G S S M M P L K S
pp022942_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P L K S
 
AT1G47270.1     W - - - - - E I S G G A D K I S R V A M S L K N I V K N K Y K A I G R R G R S H I A P E G S S V - S S S L S T N E G L N
pp022947_Pp1s22    - - - - - - - M K G G I G N I S R R S F E L K F P H H H - - - - - - - K G R S - - - - S G M V L D E S Q L R A E P V V E
pp034735_Pp1s15    L I R E F Q E M K G G R G G I S R R S F E L K F P H H H - - - - - - - K G R S - - - - S G M V L D E S Q L R V E A V V K
pp034759_Pp1s15    L I R E F Q E M K G G R G G I S R R S F E L K F P H H H - - - - - - - K G R S - - - - S G M V L D E S Q L R V E A V V K
pp005711_Pp1s21    - - - - - - - M K S G V G R I S R R S F E L K F P H H H - - - - - - - R G R S - - - - S G M V L D E S Q L N S E P V V E
pp000633_Pp1s10    L I R E F Q E M K G G I G N I S R R S F E L K F P H H H - - - - - - - R G R S - - - - S G M V L D E S Q L R P E R V V E
pp034734_Pp1s15    L I R E F Q E M K G G R G G I S R R S F E L K F P H H H - - - - - - - K G R S - - - - S G M V L D E S Q L R V E A V V K
pp022942_Pp1s22    L I R E F Q E M K G G I G N I S R R S F E L K F P H H H - - - - - - - K G R S - - - - S G M V L D E S Q L R A E P V V E
 
AT1G47270.1     Q S I W V D L P P E L L L D I I Q R I E S E Q S L W P G R R D V V A C A S V C K S W R E M T K E V V K V P E L S G L I T
pp022947_Pp1s22    Q S C W A N M P P E L L R D V I Q R V E A S E N A W P S R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T
pp034735_Pp1s15    Q S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T
pp034759_Pp1s15    Q S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T
pp005711_Pp1s21    Q S C W A N M P P E L L R D V I Q R V E A S E S A W P S R K H V V A C A A V C S S W R E V T K E L V R A P E Q S G R L T
pp000633_Pp1s10    Q S C W A N M P P E L L R D V I Q R V E V S E S T W P S R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T
pp034734_Pp1s15    Q S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T
pp022942_Pp1s22    Q S C W A N M P P E L L R D V I Q R V E A S E N A W P S R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T
 
AT1G47270.1     F P I S L R Q P G P R D A P I Q C F I K R E R A T G I Y R L Y L G L S P A L S G D K S K L L L S A K R V R R A T G A E F
pp022947_Pp1s22    F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S L V - E N G K F L L A A R K F R R A T S T D Y
pp034735_Pp1s15    F P I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S L V - E N G K F L L A A R K F R R A A S T D Y
pp034759_Pp1s15    F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P T L V - E N G K F L L A A K K F R R P T R T D Y
pp005711_Pp1s21    F P V A L K Q P G P R E D T V Q C F I K R D R T T S T Y Q L F L G L P P S Q - - E N G K F L L A A Q K F R R A T S T D Y
pp000633_Pp1s10    F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S L I - E N G K F L L A A R K F R R A T S T D Y
pp034734_Pp1s15    F P I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S L V - E N G K F L L A A R K F R R A A S T D Y
pp022942_Pp1s22    F P I A L K Q P G P R D S T M Q C F I K R D R T T S T Y Q L F L G L P P S L V - E N G K F L L A A R K C R R A T S T D Y
 
AT1G47270.1     V V S L S G N D F S R S S S N Y I G K L R S N F L G T K F T V Y E N Q P P - - - - - P F N R - - K L P P S M Q V S P W V
pp022947_Pp1s22    I I S L N Q E N M S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H S G V V A S N R G T R R M G S K Q L T S R V
pp034735_Pp1s15    I I S L N Q E D I S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N R G A W R M G T K Q L S S R V
pp034759_Pp1s15    I I S L N H D D M S R G G T A Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N R G A W R M G T K Q L S S R V
pp005711_Pp1s21    I I S L N Q E D M S R G S S T Y V G K L R S N F L G T K F T I Y D S Q P P Q N G P V L S N R S S R R L T S K Q L S Y R A
pp000633_Pp1s10    I I S L N Q E D M S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H N R G V A S N R S S R R I G S K Q L T S R V
pp034734_Pp1s15    I I S L N Q E D I S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N R G A W R M G T K Q L S S R V
pp022942_Pp1s22    I V S L N H E D M S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H S G V V A S N R G T R R L G S K Q L T S R V
 
AT1G47270.1     S S S S S S Y N I A S I L Y E L N V L R T R G P R R M Q C I M H S I P I S A I Q E G G K I Q S P T E F T N Q G - - - - -
pp022947_Pp1s22    - - H C G S Y N V A H I A Y E L N V L G T R G P R R M Q C T M H S I P A S A M A S G G S A P T P T E F T S C G L E E A H
pp034735_Pp1s15    - - H S G S Y N V A H I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E L A A G S L E E V H
pp034759_Pp1s15    - - H S G S Y N V A H I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E L A A G S L E E V H
pp005711_Pp1s21    - - H A G S F N V A H I A Y E L N V L G T R G P R R M Q C T L H G I P L S T M E S V G S A P S P T E V T A D S L E R A H
pp000633_Pp1s10    - - H A G S Y N V A H I A Y E L N V L G T R G P R R M Q C M L H T I P M S A M E S G G S A P T P T E F T A S T L E D T H
pp034734_Pp1s15    - - H S G S Y N V A H I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E L A A G S L E E V H
pp022942_Pp1s22    - - H C G S H N V A H I A Y E L N V L G T R G P R R M Q C T M H S I P A S A M A S G G S A P T P T E F T S C G L E E A H
 
AT1G47270.1     - - - - - - - - - K K K K K P L M D - - - - - - - - F C S G N L G G E S V I K E P L I L K N K S P R W H E Q L Q C W C L
pp022947_Pp1s22    V P Y S S I L L S P R S K A A V V D S S A L E S S E L V S G V L C K E - - - - E P L V L K N K A P R W H E Q L Q C W C L
pp034735_Pp1s15    V P Y S S I M S S P R S K A A V V D S S A L E S S E F V S G L L N K E - - - - E P L V L R N K A P R W H E Q L Q C W C L
pp034759_Pp1s15    V P Y S S I M S S P R S K A A V V D S S A L E S S E F V S G L L N K E - - - - E P L V L R N K A P R W H E Q L Q C W C L
pp005711_Pp1s21    V P H S G V M S S S R S K A A V V D I S T L D - Y D F A S G L L A K D - - - - E P L V L K N K A P R W H E Q L Q C W C L
pp000633_Pp1s10    V A Y S G I L S S P R S R A A V V D S S T L D - C D F V S G P L T K D - - - - A P L I L K N K A P R W H E Q L Q C W C L
pp034734_Pp1s15    V P Y S S I M S S P R S K A A V V D S S A L E S S E F V S G L L N K E - - - - E P L V L R N K A P R W H E Q L Q C W C L
pp022942_Pp1s22    V P Y S S I L L S P R S K A A V V D S S A L E S S E L V S G V L C K E - - - - E P L V L K N K A P R W H E Q L Q C W C L
 
AT1G47270.1     N F K G R V T V A S V K N F Q L V A A - - - - - - - - - - A A E A G K N M - - - - - - - - - - - - - N I P E E E Q D R V
pp022947_Pp1s22    N F R G R V T V A S V K N F Q L V A A T T S S T T T S T T A G E A A A A T G G G G G A G A A T P A P T S S G S D H D K V
pp034735_Pp1s15    N F R G R V T V A S V K N F Q L V A A - - - - - - T S V K A V S A A A T T - - - - - - - - - - - - - S S S S A D H D K V
pp034759_Pp1s15    N F R G R V T V A S V K N F Q L V A A - - - - - - T S V K A V S A A A T T - - - - - - - - - - - - - S S S S A D H D K V
pp005711_Pp1s21    N F R G R V T V A S V K N F Q L V A S M E S - - - - - - - - - - - - - - - - - - - - - - - - - - L P T S S Q S D R D K V
pp000633_Pp1s10    N F R G R V T V A S V K N F Q L V A A T D L - - - - - - - - - - - - - - - - - - - - - - - - - - P P T N S Q N D H D K V
pp034734_Pp1s15    N F R G R V T V A S V K N F Q L V A A - - - - - - T S V K A V S A A A T T - - - - - - - - - - - - - S S S S A D H D K V
pp022942_Pp1s22    N F R G R V T V A S V K N F Q L V A A T T S S T T T S T T A G E A A A A T G G G G G A G A A T P A P T S S G S D H D K V
 
AT1G47270.1     I L Q F G K I G K D I F T M D Y R Y P I S A F Q A F A I C L S S F D T K P V C E
pp022947_Pp1s22    L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp034735_Pp1s15    L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp034759_Pp1s15    L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp005711_Pp1s21    L L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp000633_Pp1s10    L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp034734_Pp1s15    L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp022942_Pp1s22    L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
 
0