fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT1G47270.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Gm001764 not found in 415aa AT2G18280.2 not_not 0.546261089 III
Gm030081 not found in 414aa AT2G18280.2 not_not 0.543726235 III
Gm030080 not found in 414aa AT2G18280.2 not_not 0.543726235 III
Gm003133 not found in 414aa AT2G18280.2 not_not 0.532319391 III
Gm044675 not found in 414aa AT2G18280.2 not_not 0.528517110 III
Gm041219 not found in 427aa AT1G25280.1 not_not 0.496831432 III
Gm028527 not found in 430aa AT1G25280.1 not_not 0.496831432 III
Gm028526 not found in 430aa AT1G25280.1 not_not 0.496831432 III
Gm003397 not found in 424aa AT1G25280.1 not_not 0.494296577 III
Gm003395 not found in 424aa AT1G25280.1 not_not 0.494296577 III
Gm021743 not found in 427aa AT1G25280.1 not_not 0.493029150 III
Gm021742 not found in 427aa AT1G25280.1 not_not 0.493029150 III
Gm021741 not found in 427aa AT1G25280.1 not_not 0.493029150 III
Gm021740 not found in 427aa AT1G25280.1 not_not 0.493029150 III
Gm054929 not found in 430aa AT1G25280.1 not_not 0.493029150 III
Gm054928 not found in 430aa AT1G25280.1 not_not 0.493029150 III
Gm044960 not found in 424aa AT1G25280.1 not_not 0.491761723 III
Gm044959 not found in 424aa AT1G25280.1 not_not 0.491761723 III
Gm004126 not found in 400aa AT2G47900.2 not_not 0.490494296 III
Gm036751 not found in 389aa AT2G47900.2 not_not 0.467680608 III
Gm041730 not found in 385aa AT2G47900.2 not_not 0.465145754 III
Gm045746 not found in 362aa AT2G47900.2 not_not 0.437262357 III
Gm045745 not found in 362aa AT2G47900.2 not_not 0.437262357 III
Gm019438 not found in 359aa AT2G47900.2 not_not 0.434727503 III
Gm045744 not found in 392aa AT2G47900.2 not_not 0.416983523 III
Gm003396 not found in 407aa AT1G25280.1 not_not 0.414448669 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT1G47270.1     MDLSLLLPKRSWEISGGADKISRVAMSLKNIV---KNKYKAIG---RRG-----------
gm045744_Glyma1 ------------------------------------------------------------
gm028526_Glyma1 -------------------------MSFRSIV---REVRDGFGSLSRRSFEVRLPGHNRG
gm045745_Glyma1 ------------------------------------------------------------
gm003397_Glyma0 -------------------------MSFRSIV---RDVRDGFGSLSRRSFDVRISGG--G
gm044675_Glyma1 -------------------------MSLRSIVRELKEMRDGIGSTSKRGAESK---HWLS
gm021740_Glyma0 -------------------------MSFRSIV---RDVRDSFGSLSRRSFDVRLTGHHRG
gm021743_Glyma0 -------------------------MSFRSIV---RDVRDSFGSLSRRSFDVRLTGHHRG
gm030080_Glyma1 -------------------------MSLKSIVRELKEMRDGIGSMSRRGVESR---RWNG
gm003133_Glyma0 -------------------------MSLRSIVRELKEMRDGIGSTSKRGAESK---HRLS
gm041730_Glyma1 ------------------------------MC------------LIR---------SMRS
gm041219_Glyma1 -------------------------MSFRSIV---RDVRDSFGSLSRRSFDVRLTGHHRG
gm044960_Glyma1 -------------------------MSFRSIV---RDVRDGFGSLSRRSFDVRLSGG--G
gm054929_Glyma2 -------------------------MSFRSIV---RDVRDGFGSLSRRSFEVRLPGHNRG
gm003395_Glyma0 -------------------------MSFRSIV---RDVRDGFGSLSRRSFDVRISGG--G
gm028527_Glyma1 -------------------------MSFRSIV---REVRDGFGSLSRRSFEVRLPGHNRG
gm030081_Glyma1 -------------------------MSLKSIVRELKEMRDGIGSMSRRGVESR---RWNG
gm021741_Glyma0 -------------------------MSFRSIV---RDVRDSFGSLSRRSFDVRLTGHHRG
gm003396_Glyma0 -------------------------MSFRSIV---RDVRDGFGSLSRRSFDVRISGG--G
gm021742_Glyma0 -------------------------MSFRSIV---RDVRDSFGSLSRRSFDVRLTGHHRG
gm044959_Glyma1 -------------------------MSFRSIV---RDVRDGFGSLSRRSFDVRLSGG--G
gm004126_Glyma0 -------------------------MSFRSII------------LERKGFEVKFGYSMRS
gm054928_Glyma2 -------------------------MSFRSIV---RDVRDGFGSLSRRSFEVRLPGHNRG
gm019438_Glyma0 ------------------------------------------------------------
gm036751_Glyma1 ------------------------------MG------------LIR---------SMRS
gm045746_Glyma1 ------------------------------------------------------------
gm001764_Glyma0 -------------------------MSLKSIVRELKEMRDGIGSMSRRGVESR---RWNG
                                                                            

AT1G47270.1     --RS---HIAPEGSSVSSS-LSTNEGLNQSIWVDLPPELLLDIIQRIESEQSLWPGRRDV
gm045744_Glyma1 --------MIEVQ----------ANAMEQSWWANMPHELLREVLLRIESSESTWPLRRSV
gm028526_Glyma1 KSR----SLVHELQDQPPV-------IQNSRWASLPPELLRDVINRLEASESTWPGRKHV
gm045745_Glyma1 --------MIEVQ----------ANAMEQSWWANMPHELLREVLLRIESSESTWPLRRSV
gm003397_Glyma0 KLN----SLVHEAHERQLV-------IQNSRWASLPPELLCDVIKRLEESESTWPARKHV
gm044675_Glyma1 RTKS---HVAPD-----IL-ATPFEPIQQGQWANLPSELLLDIIQRIEESETSWPARAVV
gm021740_Glyma0 KSQ----GSVQDLHDQPLV-------IQNSRWASLPPELLFDIIRRLEESENTWPARKHV
gm021743_Glyma0 KSQ----GSVQDLHDQPLV-------IQNSRWASLPPELLFDIIRRLEESENTWPARKHV
gm030080_Glyma1 RTKS---HVAPD-----VT-LTSLEPIQQGHWANLPPELLLDIIRRVEDSETTWPARAVV
gm003133_Glyma0 RTKS---HVAPD-----VL-ATPFEPIQQGQWANLPSELLLDIIQRVEESETSWPARAVV
gm041730_Glyma1 QSQ----RVVQEQEEAEC----VGDSMRQSCWANMPQELLREVLFRIEASEDAWPPRKSV
gm041219_Glyma1 KSQ----GSVQDLHDQPLV-------IQNSRWASLPPELLFDIIRRLEESENTWPARKHV
gm044960_Glyma1 KSN----SLVHEEHECLPV-------VQNSRWASLPPELLRDVIKRLEESETTWPARKHV
gm054929_Glyma2 KSR----SSVHELQDQPPV-------IQNSRWASLPPELLRDVINRLEASESTWPGRKHV
gm003395_Glyma0 KLN----SLVHEAHERQLV-------IQNSRWASLPPELLCDVIKRLEESESTWPARKHV
gm028527_Glyma1 KSR----SLVHELQDQPPV-------IQNSRWASLPPELLRDVINRLEASESTWPGRKHV
gm030081_Glyma1 RTKS---HVAPD-----VT-LTSLEPIQQGHWANLPPELLLDIIRRVEDSETTWPARAVV
gm021741_Glyma0 KSQ----GSVQDLHDQPLV-------IQNSRWASLPPELLFDIIRRLEESENTWPARKHV
gm003396_Glyma0 KLN----SLVHEAHERQLV-------IQNSRWASLPPELLCDVIKRLEESESTWPARKHV
gm021742_Glyma0 KSQ----GSVQDLHDQPLV-------IQNSRWASLPPELLFDIIRRLEESENTWPARKHV
gm044959_Glyma1 KSN----SLVHEEHECLPV-------VQNSRWASLPPELLRDVIKRLEESETTWPARKHV
gm004126_Glyma0 RSQSHSDAIAQDS-------LVVLDGLKQSCWANMPPELLRDVLMRIEASEDSWPAQKHV
gm054928_Glyma2 KSR----SSVHELQDQPPV-------IQNSRWASLPPELLRDVINRLEASESTWPGRKHV
gm019438_Glyma0 --------------------------MEQSWRANMPRELLREVLLRIESSEATWPSRRSV
gm036751_Glyma1 RSQ----RVVQEQEAAECVGVVVGDSMRQSCWANMPQELLREVLLRIEASEDTWPPRKSV
gm045746_Glyma1 --------MIEVQ----------ANAMEQSWWANMPHELLREVLLRIESSESTWPLRRSV
gm001764_Glyma0 RTKS---HVAPD-----VI-LTSLEPIQQGQWANLPPELLLDIIRRVEDSETTWPARAVV
                                          :.:.  ..:* *** ::: *:* .:  ** :  *

AT1G47270.1     VACASVCKSW-REMTKEVVKVPELSGLITFPISLRQPGPRDAPIQCFIKRERATGIYRLY
gm045744_Glyma1 VACGGVCRTWRRLIVKEIVKPPQFSSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLF
gm028526_Glyma1 VACAAVCKSW-REMCKEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLF
gm045745_Glyma1 VACGGVCRTWRRLIVKEIVKPPQFSSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLF
gm003397_Glyma0 VACAAVCKSW-REMCKEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLF
gm044675_Glyma1 VFCASVCKSW-RSITREIVKTPEQCGRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLY
gm021740_Glyma0 VACAAVCQSW-RNMCKDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLF
gm021743_Glyma0 VACAAVCQSW-RNMCKDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLF
gm030080_Glyma1 VYCGSVCKSW-RAVTKEIVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLY
gm003133_Glyma0 VFCASVCKSW-RSITREIVKTPEQCGRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLY
gm041730_Glyma1 VACAGVCRSW-RQITIDIVKTPELSSKITFPISVKQPGPRENLLRCFIKRNRSSQTYYLY
gm041219_Glyma1 VACAAVCQSW-RNMCKDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLF
gm044960_Glyma1 VACAAVCRSW-RGMCKEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLF
gm054929_Glyma2 VACAAVCKSW-REMCKEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLF
gm003395_Glyma0 VACAAVCKSW-REMCKEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLF
gm028527_Glyma1 VACAAVCKSW-REMCKEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLF
gm030081_Glyma1 VYCGSVCKSW-RAVTKEIVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLY
gm021741_Glyma0 VACAAVCQSW-RNMCKDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLF
gm003396_Glyma0 VACAAVCKSW-REMCKEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLF
gm021742_Glyma0 VACAAVCQSW-RNMCKDIVKSPEFCGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLF
gm044959_Glyma1 VACAAVCRSW-RGMCKEIVTSPEFCGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLF
gm004126_Glyma0 VACAGVCRSW-REIMKEIVKSPQLSGKLTFPISLKQPGPRDSLLQCYIKRNRSNQTYYLF
gm054928_Glyma2 VACAAVCKSW-REMCKEIVSSPEFCGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLF
gm019438_Glyma0 VACGGVCRTW-RLIVKEIVKPPQLSSNITFPISLKQPGPREHLLQCFIRRNSATQTYYLF
gm036751_Glyma1 VSCAGVCRSW-RHITKDIVKTPELSSKITFPISVKQPGPRENLLRCFIKRNRSTQTYYLF
gm045746_Glyma1 VACGGVCRTWRRLIVKEIVKPPQFSSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLF
gm001764_Glyma0 VYCGSVCKSW-RAVTKEIVKTPEQCGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLY
                * *..**::* * :  ::*. *: .. :***:*::*** *:  ::*:*:*:  .  * *:

AT1G47270.1     LGLSPALSGDKSKLLLSAKRVRRATGAEFVVSLSGNDFSRSSSNYIGKL-----------
gm045744_Glyma1 LSLSSALVADDGKFLLAARKFRRPTCTDYIISLDADDMSRESNAYVGKLRSTLNQILLLA
gm028526_Glyma1 LGLSPALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKL-----------
gm045745_Glyma1 LSLSSALVADDGKFLLAARKFRRPTCTDYIISLDADDMSRESNAYVGKL-----------
gm003397_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL-----------
gm044675_Glyma1 FGLVPS-ENDGNKLLLAAKRIRRATGTDFIISLAADDFSRASNKYVGKL-----------
gm021740_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL-----------
gm021743_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL-----------
gm030080_Glyma1 IGLVPS-ENETDKLLLAAKKVRRATGTDFIISLVADDFSRSSNTYVGKL-----------
gm003133_Glyma0 FGLVPS-ENDSNKLLLAAKRIRRATGTGFVISLAADDFSRASNKYVGKL-----------
gm041730_Glyma1 LSLTNTL-AEDGKFLLAARKCRRPTCTDYIISLDADDMSKGSNSYVGKL-----------
gm041219_Glyma1 LCLSPALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL-----------
gm044960_Glyma1 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL-----------
gm054929_Glyma2 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSSTYIGKL-----------
gm003395_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL-----------
gm028527_Glyma1 LGLSPALLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKL-----------
gm030081_Glyma1 IGLVPS-ENETDKLLLAAKKVRRATGTDFIISLVADDFSRSSNTYVGKL-----------
gm021741_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL-----------
gm003396_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL-----------
gm021742_Glyma0 LCLSPALLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSNTYIGKL-----------
gm044959_Glyma1 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNSTYIGKL-----------
gm004126_Glyma0 LGLNQAS-TDEGKFLLSARKCRRATHTDYIISLNCDDVSRGSSTYIGKL-----------
gm054928_Glyma2 LCLSPALLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSSTYIGKL-----------
gm019438_Glyma0 LSLSSALIADDGKFLLAARKFRRPTCIDYIISLDADDMSRESNAYVGKL-----------
gm036751_Glyma1 LSLTSTL-AEDGKFLLAARKCRRPTCTDYIISLDADDMSKGSNSYVGKL-----------
gm045746_Glyma1 LSLSSALVADDGKFLLAARKFRRPTCTDYIISLDADDMSRESNAYVGKL-----------
gm001764_Glyma0 IGLVPS-ENETDKLLLAAKKVRRATGTDFVISLVADDFFRSSNTYVGKL-----------
                : *  :   : .*:**:*:: **.*   :::*:  ::. : .. *:***           

AT1G47270.1     -------------------RSNFLGTKFTVYENQPP------------PFNRK-LPPSMQ
gm045744_Glyma1 ILLFLFLSAKTNPLSSHFIRSNFLGTKFTIYD----------RKSC---STELVV-NSKQ
gm028526_Glyma1 -------------------RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSRR-F--SKK
gm045745_Glyma1 -------------------RSNFLGTKFTIYD----------RKSC---STELVV-NSKQ
gm003397_Glyma0 -------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-F-YSKK
gm044675_Glyma1 -------------------RSNFLGTKFTIFDSQAPN-DVAIQPNC--QSSRR-F-HSKQ
gm021740_Glyma0 -------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-F-YSKK
gm021743_Glyma0 -------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-F-YSKK
gm030080_Glyma1 -------------------RSNFLGTKFTIYDSQPPH-GAAIQPDS--QPSRR-F-HSKQ
gm003133_Glyma0 -------------------RSNFLGTKFTVYDSQAPH-DSAIQSNC--QSSRR-F-HSKQ
gm041730_Glyma1 -------------------RSNFLGTKFTIYDGQPPHAGAKIMKSR---STRL-V-NLKQ
gm041219_Glyma1 -------------------RSNFLGTKFIIYDTQPPYSSAHICPPGTGKTSRR-F-YSKK
gm044960_Glyma1 -------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-F-YSKK
gm054929_Glyma2 -------------------RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSRR-F--SKK
gm003395_Glyma0 -------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-F-YSKK
gm028527_Glyma1 -------------------RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSRR-F--SKK
gm030081_Glyma1 -------------------RSNFLGTKFTIYDSQPPH-GAAIQPDS--QPSRR-F-HSKQ
gm021741_Glyma0 -------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-F-YSKK
gm003396_Glyma0 -------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-F-YSKK
gm021742_Glyma0 -------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-F-YSKK
gm044959_Glyma1 -------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-F-YSKK
gm004126_Glyma0 -------------------RSNFLGTKFTVYDAHPPIYGAKVTKSR---STRL-V-SLKQ
gm054928_Glyma2 -------------------RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSRR-F--SKK
gm019438_Glyma0 -------------------RSNFLGTKFTIYDIPLPHVGAKMTKSC---FTKL-V-NPKQ
gm036751_Glyma1 -------------------RSNFLGTKFTIYDSQLPHTGAKIMKSR---STRL-V-NLKQ
gm045746_Glyma1 -------------------RSNFLGTKFTIYD----------RKSC---STELVV-NSKQ
gm001764_Glyma0 -------------------RSNFLGTKFTIYDSQPPQ-GAAIQPDN--RSSRR-F-HSKQ
                                   *******:* : :                  ..  .    :

AT1G47270.1     VS--PWVSSSSSSYNIASILYELNVLRTRGPRRMQCIMHSIPISAIQEGGK---IQSPTE
gm045744_Glyma1 VSPRPRV--PTGNYPVAHISYELNVLGSRGPRRMHCVMDTIPASAIEPGGVAVAAPSQTD
gm028526_Glyma1 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRRMNCTMYSIPASSMEPNGV---VPGQPE
gm045745_Glyma1 VSPRPRV--PTGNYPVAHISYELNVLGSRGPRRMHCVMDTIPASAIEPGGVAVAAPSQTD
gm003397_Glyma0 VS--PKV--PSGSYNIAQITYELNVLGTRGPRRMNCTMHSIPMSALEPGCT---VPGQPE
gm044675_Glyma1 VS--PRL--PACNYLVSTVSYELNVLCTRGPRRMYCVMNSIPVSAIQEGGN---APTPAS
gm021740_Glyma0 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRKMHCVMHSIPASALDAGGT---VPGQPE
gm021743_Glyma0 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRKMHCVMHSIPASALDAGGT---VPGQPE
gm030080_Glyma1 VS--PRV--PACNYVVSTIAYELNVLRARGPRRMHCTMNSIPVSAVQAGGN---APTPT-
gm003133_Glyma0 VS--PRV--PACSYLVSTVSYELNVLCTRGPRRMHCVMNSIPVSAIQEGGN---APTPTS
gm041730_Glyma1 VS--PKV--PTGNYPVAHISYELNVLGSRGPRRMHCVMDSIPAAAIEPGGV---APVQTE
gm041219_Glyma1 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRKMHCVMHSIPASALDAGGT---VPGQPE
gm044960_Glyma1 VS--PKV--PSGSYNIAQITYELNVLGTRGPRRMNCTMHSIPMSALEPGCT---VPGQPE
gm054929_Glyma2 VS--PKV--PSGSYNIAHVTYELNVLGTRGPRRMNCTMYSIPASSMEPNGI---VPGQPE
gm003395_Glyma0 VS--PKV--PSGSYNIAQITYELNVLGTRGPRRMNCTMHSIPMSALEPGCT---VPGQPE
gm028527_Glyma1 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRRMNCTMYSIPASSMEPNGV---VPGQPE
gm030081_Glyma1 VS--PRV--PACNYVVSTIAYELNVLRARGPRRMHCTMNSIPVSAVQAGGN---APTPT-
gm021741_Glyma0 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRKMHCVMHSIPASALDAGGT---VPGQPE
gm003396_Glyma0 VS--PKV--PSGSYNIAQITYELNVLGTRGPRRMNCTMHSIPMSALEPGCT---VPGQPE
gm021742_Glyma0 VS--PKV--PSGSYNIAQVTYELNVLGTRGPRKMHCVMHSIPASALDAGGT---VPGQPE
gm044959_Glyma1 VS--PKV--PSGSYNIAQITYELNVLGTRGPRRMNCTMHSIPMSALEPGCT---VPGQPE
gm004126_Glyma0 VS--PRV--PAGNYPIAHVSYDLNVLGSRGPRIMQCVMDAIPASAVEPGGV---APTQTQ
gm054928_Glyma2 VS--PKV--PSGSYNIAHVTYELNVLGTRGPRRMNCTMYSIPASSMEPNGI---VPGQPE
gm019438_Glyma0 VS--PRV--PTGNYPVAHISYELNVLGSRGPRRMHCVMDTIPASAIEPGGVAV-APSQTD
gm036751_Glyma1 VS--PKV--PTGNYPVAHISYELNVLGSRGPRRMHCVMDSIPATAIEPGGV---APTQTE
gm045746_Glyma1 VSPRPRV--PTGNYPVAHISYELNVLGSRGPRRMHCVMDTIPASAIEPGGVAVAAPSQTD
gm001764_Glyma0 VS--PRV--PACNYVVSTIAYELNVLRARGPRRMHCTMNSISVSAVQEGGN---APTPTS
                **  * :  .: .* :: : *:**** :**** * * * :*. :::: .         . 

AT1G47270.1     F----------TNQGKKKKKPLMDFCSGNLGG--------ESVIKEPLILKNKSPRWHEQ
gm045744_Glyma1 FSVSNR-DT--SFPFFQTNSTSLENSIS---------GDQSNKKDDVLVLRNKAARWHEQ
gm028526_Glyma1 LLPRALEDSFRSISFSKSIDNSTEFSSSRFSDIMGTGIEDEEGKVRPLVLKNKSPRWHEQ
gm045745_Glyma1 FSVSNR-DT--SFPFFQTNSTSLENSIS---------GDQSNKKDDVLVLRNKAARWHEQ
gm003397_Glyma0 LLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFVAGNEEEQGKGRPLVLKNKSPRWHEQ
gm044675_Glyma1 Y-PQIFDEHFSPSPALKEKVPVTDLNSASLSE-P---PVSSQCSAEQLALKNRAPRWHEQ
gm021740_Glyma0 LLPRPLEDSFRSISFSKSLDRSIEFSSSRFSEIGESIIEDDDGKMRPLVLKNKPPRWHEQ
gm021743_Glyma0 LLPRPLEDSFRSISFSKSLDRSIEFSSSRFSEIGESIIEDDDGKMRPLVLKNKPPRWHEQ
gm030080_Glyma1 F-PEIIDEPFSPSPALKGKGPIRDLDNASLPELL---PVESQGSAEPLVLKNKAPRWHEQ
gm003133_Glyma0 F-PQIFDEPFSPSPALKEKAQVTDLNSASLSE-P---PVLSQGSTEQLALKNKAPRWHEQ
gm041730_Glyma1 FSLNNI-DMFPSFPFFRSKSNRVENSVS---------GPLVDQKDGMLVLKNKAPRWHEQ
gm041219_Glyma1 LLPRSLEDSFRSISFSKSLDHSIEFSSSRFSEIGESCIEDDDGKMRPLVLKNKPPRWHEQ
gm044960_Glyma1 LLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFLAGKEEEQGKDRPLVLKNKSPRWHEQ
gm054929_Glyma2 LLPRALEDSFRSISFSKSIDNSTEFSSSRFSDIMGIGNEDEEGKVRPLVLKNKSPRWHEQ
gm003395_Glyma0 LLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFVAGNEEEQGKGRPLVLKNKSPRWHEQ
gm028527_Glyma1 LLPRALEDSFRSISFSKSIDNSTEFSSSRFSDIMGTGIEDEEGKVRPLVLKNKSPRWHEQ
gm030081_Glyma1 F-PEIIDEPFSPSPALKGKGPIRDLDNASLPELL---PVESQGSAEPLVLKNKAPRWHEQ
gm021741_Glyma0 LLPRPLEDSFRSISFSKSLDRSIEFSSSRFSEIGESIIEDDDGKMRPLVLKNKPPRWHEQ
gm003396_Glyma0 LLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFVAGNEEEQGKGRPLVLKNKSPRWHEQ
gm021742_Glyma0 LLPRPLEDSFRSISFSKSLDRSIEFSSSRFSEIGESIIEDDDGKMRPLVLKNKPPRWHEQ
gm044959_Glyma1 LLPRSLEDSFRSISFARSIDNSTEFSSSRFSDIFLAGKEEEQGKDRPLVLKNKSPRWHEQ
gm004126_Glyma0 FLHSRI-DTSPSIPFFRSKSTRMDNLPT---------VPLTCQNEGTLVLRNKSPRWHEH
gm054928_Glyma2 LLPRALEDSFRSISFSKSIDNSTEFSSSRFSDIMGIGNEDEEGKVRPLVLKNKSPRWHEQ
gm019438_Glyma0 FSVSNI-DT--SFPFFQTNSTSLENSIS---------GDQRNKKDDVLVLRNKAARWHEQ
gm036751_Glyma1 FSLNNI-DMFPSFPFFRSKSNRAENSMS---------GPLVDQKDGMLVLKNKAPRWHEQ
gm045746_Glyma1 FSVSNR-DT--SFPFFQTNSTSLENSIS---------GDQSNKKDDVLVLRNKAARWHEQ
gm001764_Glyma0 F-PQIIDEPFSPSPALKGKGPIRDLDNASLPELL---PVQSQDSAEPLVLKNKAPRWHEQ
                           .    :      :                       * *:*:..****:

AT1G47270.1     LQCWCLNFKGRVTVASVKNFQLVAAAA-------EAGKNM-NIPEE---EQDRVILQFGK
gm045744_Glyma1 LQCWCLNFHGRVTIASVKNFQLAVSPE--------------NGHAG--LQEDEVILQFGK
gm028526_Glyma1 LQCWCLNFRGRVTVASVKNFQLIASTPPAAVAPTGTGPTP-SQPTQSSSDPDKIILQFGK
gm045745_Glyma1 LQCWCLNFHGRVTIASVKNFQLAVSPE--------------NGHAG--LQEDEVILQFGK
gm003397_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA----AGAPTPSSQPAQ--SDHDKIILQFGK
gm044675_Glyma1 LQCWCLNFKGRVSVASVKNFQLVAA----------VDPSH-NISAE---EQEKVILQFGK
gm021740_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKIILQFGK
gm021743_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKIILQFGK
gm030080_Glyma1 LQCWCLNFKGRVTVASVKNFQLVSA----------VDPSH-NVSAA---EQEKVILQFGK
gm003133_Glyma0 LQCWCLNFKGRVSVASVKNFQLVAA----------VDPSH-NISAE---EQEKVILQFGK
gm041730_Glyma1 LQCWCLNFHGRVTIASVKNFQLVASAE--------------NRPAG--PEHDKIILQFGK
gm041219_Glyma1 LQCWCLNFRGRVTVASVKNFQLIAATQPAA-----GAPTP-SQPAP--PEHDKIILQFGK
gm044960_Glyma1 LQCWCLNFRGRVTVASVKNFQLIAATQPPA----TGAPTPSSQPAQ--SDHDKIILQFGK
gm054929_Glyma2 LQCWCLNFRGRVTVASVKNFQLIAATPPPAIVTTGTGPTP-SQPTQSSSDPDKIILQFGK
gm003395_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA----AGAPTPSSQPAQ--SDHDKIILQFGK
gm028527_Glyma1 LQCWCLNFRGRVTVASVKNFQLIASTPPAAVAPTGTGPTP-SQPTQSSSDPDKIILQFGK
gm030081_Glyma1 LQCWCLNFKGRVTVASVKNFQLVSA----------VDPSH-NVSAA---EQEKVILQFGK
gm021741_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKIILQFGK
gm003396_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA----AGAPTPSSQPAQ--SDHDKIILQFGK
gm021742_Glyma0 LQCWCLNFRGRVTVASVKNFQLIAATQPPA-----GAPTP-SQPAP--PEHDKIILQFGK
gm044959_Glyma1 LQCWCLNFRGRVTVASVKNFQLIAATQPPA----TGAPTPSSQPAQ--SDHDKIILQFGK
gm004126_Glyma0 LQCWCLNFNGRVTVASVKNFQLVASPK--------------NGVSE--QAQENVILQFGK
gm054928_Glyma2 LQCWCLNFRGRVTVASVKNFQLIAATPPPAIVTTGTGPTP-SQPTQSSSDPDKIILQFGK
gm019438_Glyma0 LECWCLNFHGRVTIASVKNFQLAVSPE--------------NGHAG--PQEDEVILQFGK
gm036751_Glyma1 LQCWCLNFHGRVTIASVKNFQLVASAE--------------NGPAG--PEHDKIILQFGK
gm045746_Glyma1 LQCWCLNFHGRVTIASVKNFQLAVSPE--------------NGHAG--LQEDEVILQFGK
gm001764_Glyma0 LQCWCLNFNGRVTVASVKNFQLVAA----------VDPSH-NVSAA---EQEKVILQFGK
                *:******.***::********  :                .         :.:******

AT1G47270.1     IGKDIFTMDYRYPISAFQAFAICLSSFDTKPVCE
gm045744_Glyma1 IGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm028526_Glyma1 VGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm045745_Glyma1 IGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm003397_Glyma0 VGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm044675_Glyma1 IGKDIFTMDYCYPLSTFQAFAICLSSFDTKPACE
gm021740_Glyma0 VGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm021743_Glyma0 VGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm030080_Glyma1 IGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm003133_Glyma0 IGKDIFTMDYCYPLSTFQAFAICLSSFDTKPACE
gm041730_Glyma1 VGKDLFTMDYRFPISAFQAFAICLSSFDTKIACE
gm041219_Glyma1 VGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm044960_Glyma1 VGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm054929_Glyma2 VGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm003395_Glyma0 VGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm028527_Glyma1 VGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm030081_Glyma1 IGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
gm021741_Glyma0 VGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm003396_Glyma0 --QTIYVL---LPCSVMGFFLW------------
gm021742_Glyma0 VGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
gm044959_Glyma1 VGKDIFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm004126_Glyma0 VGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
gm054928_Glyma2 VGKDMFTMDYRYPLSAFQAFAICLTSFDTKLACE
gm019438_Glyma0 VGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm036751_Glyma1 VGKDLFTMDYRYPISAFQAFAICLSSFDTKIACE
gm045746_Glyma1 IGKDLFTMDYRYPISAFQAFAICLSSFATTVACE
gm001764_Glyma0 IGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE
                  : ::.:    * *.:  *              


BoxShade v3.31 C (beta, 970507) Output
AT1G47270.1     M D L S L L L P K R S W E I S G G A D K I S R V A M S L K N I V - - - K N K Y K A I G - - - R R G - - - - - - - - - - -
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028526_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R E V R D G F G S L S R R S F E V R L P G H N R G
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F D V R I S G G - - G
gm044675_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S L R S I V R E L K E M R D G I G S T S K R G A E S K - - - H W L S
gm021740_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D S F G S L S R R S F D V R L T G H H R G
gm021743_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D S F G S L S R R S F D V R L T G H H R G
gm030080_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S L K S I V R E L K E M R D G I G S M S R R G V E S R - - - R W N G
gm003133_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S L R S I V R E L K E M R D G I G S T S K R G A E S K - - - H R L S
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M C - - - - - - - - - - - - L I R - - - - - - - - - S M R S
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D S F G S L S R R S F D V R L T G H H R G
gm044960_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F D V R L S G G - - G
gm054929_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F E V R L P G H N R G
gm003395_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F D V R I S G G - - G
gm028527_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R E V R D G F G S L S R R S F E V R L P G H N R G
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S L K S I V R E L K E M R D G I G S M S R R G V E S R - - - R W N G
gm021741_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D S F G S L S R R S F D V R L T G H H R G
gm003396_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F D V R I S G G - - G
gm021742_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D S F G S L S R R S F D V R L T G H H R G
gm044959_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F D V R L S G G - - G
gm004126_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I I - - - - - - - - - - - - L E R K G F E V K F G Y S M R S
gm054928_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I V - - - R D V R D G F G S L S R R S F E V R L P G H N R G
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M G - - - - - - - - - - - - L I R - - - - - - - - - S M R S
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - M S L K S I V R E L K E M R D G I G S M S R R G V E S R - - - R W N G
 
AT1G47270.1     - - R S - - - H I A P E G S S V S S S - L S T N E G L N Q S I W V D L P P E L L L D I I Q R I E S E Q S L W P G R R D V
gm045744_Glyma1    - - - - - - - - M I E V Q - - - - - - - - - - A N A M E Q S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V
gm028526_Glyma1    K S R - - - - S L V H E L Q D Q P P V - - - - - - - I Q N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V
gm045745_Glyma1    - - - - - - - - M I E V Q - - - - - - - - - - A N A M E Q S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V
gm003397_Glyma0    K L N - - - - S L V H E A H E R Q L V - - - - - - - I Q N S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V
gm044675_Glyma1    R T K S - - - H V A P D - - - - - I L - A T P F E P I Q Q G Q W A N L P S E L L L D I I Q R I E E S E T S W P A R A V V
gm021740_Glyma0    K S Q - - - - G S V Q D L H D Q P L V - - - - - - - I Q N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V
gm021743_Glyma0    K S Q - - - - G S V Q D L H D Q P L V - - - - - - - I Q N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V
gm030080_Glyma1    R T K S - - - H V A P D - - - - - V T - L T S L E P I Q Q G H W A N L P P E L L L D I I R R V E D S E T T W P A R A V V
gm003133_Glyma0    R T K S - - - H V A P D - - - - - V L - A T P F E P I Q Q G Q W A N L P S E L L L D I I Q R V E E S E T S W P A R A V V
gm041730_Glyma1    Q S Q - - - - R V V Q E Q E E A E C - - - - V G D S M R Q S C W A N M P Q E L L R E V L F R I E A S E D A W P P R K S V
gm041219_Glyma1    K S Q - - - - G S V Q D L H D Q P L V - - - - - - - I Q N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V
gm044960_Glyma1    K S N - - - - S L V H E E H E C L P V - - - - - - - V Q N S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V
gm054929_Glyma2    K S R - - - - S S V H E L Q D Q P P V - - - - - - - I Q N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V
gm003395_Glyma0    K L N - - - - S L V H E A H E R Q L V - - - - - - - I Q N S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V
gm028527_Glyma1    K S R - - - - S L V H E L Q D Q P P V - - - - - - - I Q N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V
gm030081_Glyma1    R T K S - - - H V A P D - - - - - V T - L T S L E P I Q Q G H W A N L P P E L L L D I I R R V E D S E T T W P A R A V V
gm021741_Glyma0    K S Q - - - - G S V Q D L H D Q P L V - - - - - - - I Q N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V
gm003396_Glyma0    K L N - - - - S L V H E A H E R Q L V - - - - - - - I Q N S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V
gm021742_Glyma0    K S Q - - - - G S V Q D L H D Q P L V - - - - - - - I Q N S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V
gm044959_Glyma1    K S N - - - - S L V H E E H E C L P V - - - - - - - V Q N S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V
gm004126_Glyma0    R S Q S H S D A I A Q D S - - - - - - - L V V L D G L K Q S C W A N M P P E L L R D V L M R I E A S E D S W P A Q K H V
gm054928_Glyma2    K S R - - - - S S V H E L Q D Q P P V - - - - - - - I Q N S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - M E Q S W R A N M P R E L L R E V L L R I E S S E A T W P S R R S V
gm036751_Glyma1    R S Q - - - - R V V Q E Q E A A E C V G V V V G D S M R Q S C W A N M P Q E L L R E V L L R I E A S E D T W P P R K S V
gm045746_Glyma1    - - - - - - - - M I E V Q - - - - - - - - - - A N A M E Q S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V
gm001764_Glyma0    R T K S - - - H V A P D - - - - - V I - L T S L E P I Q Q G Q W A N L P P E L L L D I I R R V E D S E T T W P A R A V V
 
AT1G47270.1     V A C A S V C K S W - R E M T K E V V K V P E L S G L I T F P I S L R Q P G P R D A P I Q C F I K R E R A T G I Y R L Y
gm045744_Glyma1    V A C G G V C R T W R R L I V K E I V K P P Q F S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F
gm028526_Glyma1    V A C A A V C K S W - R E M C K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F
gm045745_Glyma1    V A C G G V C R T W R R L I V K E I V K P P Q F S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F
gm003397_Glyma0    V A C A A V C K S W - R E M C K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F
gm044675_Glyma1    V F C A S V C K S W - R S I T R E I V K T P E Q C G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y
gm021740_Glyma0    V A C A A V C Q S W - R N M C K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F
gm021743_Glyma0    V A C A A V C Q S W - R N M C K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F
gm030080_Glyma1    V Y C G S V C K S W - R A V T K E I V K T P E Q C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y
gm003133_Glyma0    V F C A S V C K S W - R S I T R E I V K T P E Q C G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y
gm041730_Glyma1    V A C A G V C R S W - R Q I T I D I V K T P E L S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S S Q T Y Y L Y
gm041219_Glyma1    V A C A A V C Q S W - R N M C K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F
gm044960_Glyma1    V A C A A V C R S W - R G M C K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F
gm054929_Glyma2    V A C A A V C K S W - R E M C K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F
gm003395_Glyma0    V A C A A V C K S W - R E M C K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F
gm028527_Glyma1    V A C A A V C K S W - R E M C K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F
gm030081_Glyma1    V Y C G S V C K S W - R A V T K E I V K T P E Q C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y
gm021741_Glyma0    V A C A A V C Q S W - R N M C K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F
gm003396_Glyma0    V A C A A V C K S W - R E M C K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F
gm021742_Glyma0    V A C A A V C Q S W - R N M C K D I V K S P E F C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F
gm044959_Glyma1    V A C A A V C R S W - R G M C K E I V T S P E F C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F
gm004126_Glyma0    V A C A G V C R S W - R E I M K E I V K S P Q L S G K L T F P I S L K Q P G P R D S L L Q C Y I K R N R S N Q T Y Y L F
gm054928_Glyma2    V A C A A V C K S W - R E M C K E I V S S P E F C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F
gm019438_Glyma0    V A C G G V C R T W - R L I V K E I V K P P Q L S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A T Q T Y Y L F
gm036751_Glyma1    V S C A G V C R S W - R H I T K D I V K T P E L S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S T Q T Y Y L F
gm045746_Glyma1    V A C G G V C R T W R R L I V K E I V K P P Q F S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F
gm001764_Glyma0    V Y C G S V C K S W - R A V T K E I V K T P E Q C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y
 
AT1G47270.1     L G L S P A L S G D K S K L L L S A K R V R R A T G A E F V V S L S G N D F S R S S S N Y I G K L - - - - - - - - - - -
gm045744_Glyma1    L S L S S A L V A D D G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S N A Y V G K L R S T L N Q I L L L A
gm028526_Glyma1    L G L S P A L L V E N G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - -
gm045745_Glyma1    L S L S S A L V A D D G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S N A Y V G K L - - - - - - - - - - -
gm003397_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - -
gm044675_Glyma1    F G L V P S - E N D G N K L L L A A K R I R R A T G T D F I I S L A A D D F S R A S N K Y V G K L - - - - - - - - - - -
gm021740_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - -
gm021743_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - -
gm030080_Glyma1    I G L V P S - E N E T D K L L L A A K K V R R A T G T D F I I S L V A D D F S R S S N T Y V G K L - - - - - - - - - - -
gm003133_Glyma0    F G L V P S - E N D S N K L L L A A K R I R R A T G T G F V I S L A A D D F S R A S N K Y V G K L - - - - - - - - - - -
gm041730_Glyma1    L S L T N T L - A E D G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S N S Y V G K L - - - - - - - - - - -
gm041219_Glyma1    L C L S P A L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - -
gm044960_Glyma1    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - -
gm054929_Glyma2    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - -
gm003395_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - -
gm028527_Glyma1    L G L S P A L L V E N G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - -
gm030081_Glyma1    I G L V P S - E N E T D K L L L A A K K V R R A T G T D F I I S L V A D D F S R S S N T Y V G K L - - - - - - - - - - -
gm021741_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - -
gm003396_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - -
gm021742_Glyma0    L C L S P A L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N T Y I G K L - - - - - - - - - - -
gm044959_Glyma1    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S T Y I G K L - - - - - - - - - - -
gm004126_Glyma0    L G L N Q A S - T D E G K F L L S A R K C R R A T H T D Y I I S L N C D D V S R G S S T Y I G K L - - - - - - - - - - -
gm054928_Glyma2    L C L S P A L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S S S T Y I G K L - - - - - - - - - - -
gm019438_Glyma0    L S L S S A L I A D D G K F L L A A R K F R R P T C I D Y I I S L D A D D M S R E S N A Y V G K L - - - - - - - - - - -
gm036751_Glyma1    L S L T S T L - A E D G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S N S Y V G K L - - - - - - - - - - -
gm045746_Glyma1    L S L S S A L V A D D G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S N A Y V G K L - - - - - - - - - - -
gm001764_Glyma0    I G L V P S - E N E T D K L L L A A K K V R R A T G T D F V I S L V A D D F F R S S N T Y V G K L - - - - - - - - - - -
 
AT1G47270.1     - - - - - - - - - - - - - - - - - - - R S N F L G T K F T V Y E N Q P P - - - - - - - - - - - - P F N R K - L P P S M Q
gm045744_Glyma1    I L L F L F L S A K T N P L S S H F I R S N F L G T K F T I Y D - - - - - - - - - - R K S C - - - S T E L V V - N S K Q
gm028526_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R R - F - - S K K
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K S C - - - S T E L V V - N S K Q
gm003397_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F - Y S K K
gm044675_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I F D S Q A P N - D V A I Q P N C - - Q S S R R - F - H S K Q
gm021740_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F - Y S K K
gm021743_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F - Y S K K
gm030080_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H - G A A I Q P D S - - Q P S R R - F - H S K Q
gm003133_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T V Y D S Q A P H - D S A I Q S N C - - Q S S R R - F - H S K Q
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D G Q P P H A G A K I M K S R - - - S T R L - V - N L K Q
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y S S A H I C P P G T G K T S R R - F - Y S K K
gm044960_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F - Y S K K
gm054929_Glyma2    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R R - F - - S K K
gm003395_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F - Y S K K
gm028527_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R R - F - - S K K
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H - G A A I Q P D S - - Q P S R R - F - H S K Q
gm021741_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F - Y S K K
gm003396_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F - Y S K K
gm021742_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F - Y S K K
gm044959_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F - Y S K K
gm004126_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T V Y D A H P P I Y G A K V T K S R - - - S T R L - V - S L K Q
gm054928_Glyma2    - - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R R - F - - S K K
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D I P L P H V G A K M T K S C - - - F T K L - V - N P K Q
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K S R - - - S T R L - V - N L K Q
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K S C - - - S T E L V V - N S K Q
gm001764_Glyma0    - - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P Q - G A A I Q P D N - - R S S R R - F - H S K Q
 
AT1G47270.1     V S - - P W V S S S S S S Y N I A S I L Y E L N V L R T R G P R R M Q C I M H S I P I S A I Q E G G K - - - I Q S P T E
gm045744_Glyma1    V S P R P R V - - P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D T I P A S A I E P G G V A V A A P S Q T D
gm028526_Glyma1    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R R M N C T M Y S I P A S S M E P N G V - - - V P G Q P E
gm045745_Glyma1    V S P R P R V - - P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D T I P A S A I E P G G V A V A A P S Q T D
gm003397_Glyma0    V S - - P K V - - P S G S Y N I A Q I T Y E L N V L G T R G P R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E
gm044675_Glyma1    V S - - P R L - - P A C N Y L V S T V S Y E L N V L C T R G P R R M Y C V M N S I P V S A I Q E G G N - - - A P T P A S
gm021740_Glyma0    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E
gm021743_Glyma0    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E
gm030080_Glyma1    V S - - P R V - - P A C N Y V V S T I A Y E L N V L R A R G P R R M H C T M N S I P V S A V Q A G G N - - - A P T P T -
gm003133_Glyma0    V S - - P R V - - P A C S Y L V S T V S Y E L N V L C T R G P R R M H C V M N S I P V S A I Q E G G N - - - A P T P T S
gm041730_Glyma1    V S - - P K V - - P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D S I P A A A I E P G G V - - - A P V Q T E
gm041219_Glyma1    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E
gm044960_Glyma1    V S - - P K V - - P S G S Y N I A Q I T Y E L N V L G T R G P R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E
gm054929_Glyma2    V S - - P K V - - P S G S Y N I A H V T Y E L N V L G T R G P R R M N C T M Y S I P A S S M E P N G I - - - V P G Q P E
gm003395_Glyma0    V S - - P K V - - P S G S Y N I A Q I T Y E L N V L G T R G P R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E
gm028527_Glyma1    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R R M N C T M Y S I P A S S M E P N G V - - - V P G Q P E
gm030081_Glyma1    V S - - P R V - - P A C N Y V V S T I A Y E L N V L R A R G P R R M H C T M N S I P V S A V Q A G G N - - - A P T P T -
gm021741_Glyma0    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E
gm003396_Glyma0    V S - - P K V - - P S G S Y N I A Q I T Y E L N V L G T R G P R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E
gm021742_Glyma0    V S - - P K V - - P S G S Y N I A Q V T Y E L N V L G T R G P R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E
gm044959_Glyma1    V S - - P K V - - P S G S Y N I A Q I T Y E L N V L G T R G P R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E
gm004126_Glyma0    V S - - P R V - - P A G N Y P I A H V S Y D L N V L G S R G P R I M Q C V M D A I P A S A V E P G G V - - - A P T Q T Q
gm054928_Glyma2    V S - - P K V - - P S G S Y N I A H V T Y E L N V L G T R G P R R M N C T M Y S I P A S S M E P N G I - - - V P G Q P E
gm019438_Glyma0    V S - - P R V - - P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D T I P A S A I E P G G V A V - A P S Q T D
gm036751_Glyma1    V S - - P K V - - P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D S I P A T A I E P G G V - - - A P T Q T E
gm045746_Glyma1    V S P R P R V - - P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D T I P A S A I E P G G V A V A A P S Q T D
gm001764_Glyma0    V S - - P R V - - P A C N Y V V S T I A Y E L N V L R A R G P R R M H C T M N S I S V S A V Q E G G N - - - A P T P T S
 
AT1G47270.1     F - - - - - - - - - - T N Q G K K K K K P L M D F C S G N L G G - - - - - - - - E S V I K E P L I L K N K S P R W H E Q
gm045744_Glyma1    F S V S N R - D T - - S F P F F Q T N S T S L E N S I S - - - - - - - - - G D Q S N K K D D V L V L R N K A A R W H E Q
gm028526_Glyma1    L L P R A L E D S F R S I S F S K S I D N S T E F S S S R F S D I M G T G I E D E E G K V R P L V L K N K S P R W H E Q
gm045745_Glyma1    F S V S N R - D T - - S F P F F Q T N S T S L E N S I S - - - - - - - - - G D Q S N K K D D V L V L R N K A A R W H E Q
gm003397_Glyma0    L L P R S L E D S F R S I S F A R S I D N S T E F S S S R F S D I F V A G N E E E Q G K G R P L V L K N K S P R W H E Q
gm044675_Glyma1    Y - P Q I F D E H F S P S P A L K E K V P V T D L N S A S L S E - P - - - P V S S Q C S A E Q L A L K N R A P R W H E Q
gm021740_Glyma0    L L P R P L E D S F R S I S F S K S L D R S I E F S S S R F S E I G E S I I E D D D G K M R P L V L K N K P P R W H E Q
gm021743_Glyma0    L L P R P L E D S F R S I S F S K S L D R S I E F S S S R F S E I G E S I I E D D D G K M R P L V L K N K P P R W H E Q
gm030080_Glyma1    F - P E I I D E P F S P S P A L K G K G P I R D L D N A S L P E L L - - - P V E S Q G S A E P L V L K N K A P R W H E Q
gm003133_Glyma0    F - P Q I F D E P F S P S P A L K E K A Q V T D L N S A S L S E - P - - - P V L S Q G S T E Q L A L K N K A P R W H E Q
gm041730_Glyma1    F S L N N I - D M F P S F P F F R S K S N R V E N S V S - - - - - - - - - G P L V D Q K D G M L V L K N K A P R W H E Q
gm041219_Glyma1    L L P R S L E D S F R S I S F S K S L D H S I E F S S S R F S E I G E S C I E D D D G K M R P L V L K N K P P R W H E Q
gm044960_Glyma1    L L P R S L E D S F R S I S F A R S I D N S T E F S S S R F S D I F L A G K E E E Q G K D R P L V L K N K S P R W H E Q
gm054929_Glyma2    L L P R A L E D S F R S I S F S K S I D N S T E F S S S R F S D I M G I G N E D E E G K V R P L V L K N K S P R W H E Q
gm003395_Glyma0    L L P R S L E D S F R S I S F A R S I D N S T E F S S S R F S D I F V A G N E E E Q G K G R P L V L K N K S P R W H E Q
gm028527_Glyma1    L L P R A L E D S F R S I S F S K S I D N S T E F S S S R F S D I M G T G I E D E E G K V R P L V L K N K S P R W H E Q
gm030081_Glyma1    F - P E I I D E P F S P S P A L K G K G P I R D L D N A S L P E L L - - - P V E S Q G S A E P L V L K N K A P R W H E Q
gm021741_Glyma0    L L P R P L E D S F R S I S F S K S L D R S I E F S S S R F S E I G E S I I E D D D G K M R P L V L K N K P P R W H E Q
gm003396_Glyma0    L L P R S L E D S F R S I S F A R S I D N S T E F S S S R F S D I F V A G N E E E Q G K G R P L V L K N K S P R W H E Q
gm021742_Glyma0    L L P R P L E D S F R S I S F S K S L D R S I E F S S S R F S E I G E S I I E D D D G K M R P L V L K N K P P R W H E Q
gm044959_Glyma1    L L P R S L E D S F R S I S F A R S I D N S T E F S S S R F S D I F L A G K E E E Q G K D R P L V L K N K S P R W H E Q
gm004126_Glyma0    F L H S R I - D T S P S I P F F R S K S T R M D N L P T - - - - - - - - - V P L T C Q N E G T L V L R N K S P R W H E H
gm054928_Glyma2    L L P R A L E D S F R S I S F S K S I D N S T E F S S S R F S D I M G I G N E D E E G K V R P L V L K N K S P R W H E Q
gm019438_Glyma0    F S V S N I - D T - - S F P F F Q T N S T S L E N S I S - - - - - - - - - G D Q R N K K D D V L V L R N K A A R W H E Q
gm036751_Glyma1    F S L N N I - D M F P S F P F F R S K S N R A E N S M S - - - - - - - - - G P L V D Q K D G M L V L K N K A P R W H E Q
gm045746_Glyma1    F S V S N R - D T - - S F P F F Q T N S T S L E N S I S - - - - - - - - - G D Q S N K K D D V L V L R N K A A R W H E Q
gm001764_Glyma0    F - P Q I I D E P F S P S P A L K G K G P I R D L D N A S L P E L L - - - P V Q S Q D S A E P L V L K N K A P R W H E Q
 
AT1G47270.1     L Q C W C L N F K G R V T V A S V K N F Q L V A A A A - - - - - - - E A G K N M - N I P E E - - - E Q D R V I L Q F G K
gm045744_Glyma1    L Q C W C L N F H G R V T I A S V K N F Q L A V S P E - - - - - - - - - - - - - - N G H A G - - L Q E D E V I L Q F G K
gm028526_Glyma1    L Q C W C L N F R G R V T V A S V K N F Q L I A S T P P A A V A P T G T G P T P - S Q P T Q S S S D P D K I I L Q F G K
gm045745_Glyma1    L Q C W C L N F H G R V T I A S V K N F Q L A V S P E - - - - - - - - - - - - - - N G H A G - - L Q E D E V I L Q F G K
gm003397_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - A G A P T P S S Q P A Q - - S D H D K I I L Q F G K
gm044675_Glyma1    L Q C W C L N F K G R V S V A S V K N F Q L V A A - - - - - - - - - - V D P S H - N I S A E - - - E Q E K V I L Q F G K
gm021740_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I I L Q F G K
gm021743_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I I L Q F G K
gm030080_Glyma1    L Q C W C L N F K G R V T V A S V K N F Q L V S A - - - - - - - - - - V D P S H - N V S A A - - - E Q E K V I L Q F G K
gm003133_Glyma0    L Q C W C L N F K G R V S V A S V K N F Q L V A A - - - - - - - - - - V D P S H - N I S A E - - - E Q E K V I L Q F G K
gm041730_Glyma1    L Q C W C L N F H G R V T I A S V K N F Q L V A S A E - - - - - - - - - - - - - - N R P A G - - P E H D K I I L Q F G K
gm041219_Glyma1    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P A A - - - - - G A P T P - S Q P A P - - P E H D K I I L Q F G K
gm044960_Glyma1    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - T G A P T P S S Q P A Q - - S D H D K I I L Q F G K
gm054929_Glyma2    L Q C W C L N F R G R V T V A S V K N F Q L I A A T P P P A I V T T G T G P T P - S Q P T Q S S S D P D K I I L Q F G K
gm003395_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - A G A P T P S S Q P A Q - - S D H D K I I L Q F G K
gm028527_Glyma1    L Q C W C L N F R G R V T V A S V K N F Q L I A S T P P A A V A P T G T G P T P - S Q P T Q S S S D P D K I I L Q F G K
gm030081_Glyma1    L Q C W C L N F K G R V T V A S V K N F Q L V S A - - - - - - - - - - V D P S H - N V S A A - - - E Q E K V I L Q F G K
gm021741_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I I L Q F G K
gm003396_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - A G A P T P S S Q P A Q - - S D H D K I I L Q F G K
gm021742_Glyma0    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - - G A P T P - S Q P A P - - P E H D K I I L Q F G K
gm044959_Glyma1    L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P P A - - - - T G A P T P S S Q P A Q - - S D H D K I I L Q F G K
gm004126_Glyma0    L Q C W C L N F N G R V T V A S V K N F Q L V A S P K - - - - - - - - - - - - - - N G V S E - - Q A Q E N V I L Q F G K
gm054928_Glyma2    L Q C W C L N F R G R V T V A S V K N F Q L I A A T P P P A I V T T G T G P T P - S Q P T Q S S S D P D K I I L Q F G K
gm019438_Glyma0    L E C W C L N F H G R V T I A S V K N F Q L A V S P E - - - - - - - - - - - - - - N G H A G - - P Q E D E V I L Q F G K
gm036751_Glyma1    L Q C W C L N F H G R V T I A S V K N F Q L V A S A E - - - - - - - - - - - - - - N G P A G - - P E H D K I I L Q F G K
gm045746_Glyma1    L Q C W C L N F H G R V T I A S V K N F Q L A V S P E - - - - - - - - - - - - - - N G H A G - - L Q E D E V I L Q F G K
gm001764_Glyma0    L Q C W C L N F N G R V T V A S V K N F Q L V A A - - - - - - - - - - V D P S H - N V S A A - - - E Q E K V I L Q F G K
 
AT1G47270.1     I G K D I F T M D Y R Y P I S A F Q A F A I C L S S F D T K P V C E
gm045744_Glyma1    I G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm028526_Glyma1    V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm045745_Glyma1    I G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm003397_Glyma0    V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm044675_Glyma1    I G K D I F T M D Y C Y P L S T F Q A F A I C L S S F D T K P A C E
gm021740_Glyma0    V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm021743_Glyma0    V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm030080_Glyma1    I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm003133_Glyma0    I G K D I F T M D Y C Y P L S T F Q A F A I C L S S F D T K P A C E
gm041730_Glyma1    V G K D L F T M D Y R F P I S A F Q A F A I C L S S F D T K I A C E
gm041219_Glyma1    V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm044960_Glyma1    V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm054929_Glyma2    V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm003395_Glyma0    V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm028527_Glyma1    V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm030081_Glyma1    I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
gm021741_Glyma0    V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm003396_Glyma0    - - Q T I Y V L - - - L P C S V M G F F L W - - - - - - - - - - - -
gm021742_Glyma0    V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
gm044959_Glyma1    V G K D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm004126_Glyma0    V G K D V F T M D Y Q Y P I S A F Q A F A I C L S S F D T K I A C E
gm054928_Glyma2    V G K D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
gm019438_Glyma0    V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm036751_Glyma1    V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
gm045746_Glyma1    I G K D L F T M D Y R Y P I S A F Q A F A I C L S S F A T T V A C E
gm001764_Glyma0    I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E
 
0