fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT2G18280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os009468 not found in 428aa AT2G18280.2 1st_not 0.549071618 II
Sb027814 not found in 706aa AT2G18280.2 1st_not 0.567639257 II
Gm030081 not found in 414aa AT2G18280.2 1st_not 0.644562334 II
Pt037559 not found in 416aa AT2G18280.2 1st_not 0.620689655 II
Pp000633 not found in 474aa AT2G47900.2 1st_not 0.531830238 II
Sm012016 ATSTYHLCLGLSPNFD in 155/430 AT2G47900.2 1st_not 0.521220159 II

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (1 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT2G18280.1     ---------------------------------------------------------MSL
pt037559_POPTR_ ---------------------------------------------------------MSI
Sm012016_Selmo1 ---------------------------------------------MSGKKSSSSSSLLPL
gm030081_Glyma1 ---------------------------------------------------------MSL
Sb027814_Sorbi1 -------------------------------------------------------AAMSL
Os009468_Os02t0 ---------------------------------------------------------MSL
pp000633_Pp1s10 MLASECLTVHGLRRWLKLWLILLKRSLEGIWCEVSRRELGFCKWTMSGQK---SSSMMPL
                                                                         :.:

AT2G18280.1     KSILRDLKEVRDGLGGISKR------------SWSKSSHIAPDQTTPPLDNIP-------
pt037559_POPTR_ KSIVRELKEMKDGIGNISRR---GLEGK-HWRGRARS-HIAPDETPAETDQIE-------
Sm012016_Selmo1 RSILREFQDIRDGIGSLSRR---SFEVRLPYHHRSRSHSVVLDEPPVRDVVVLQ------
gm030081_Glyma1 KSIVRELKEMRDGIGSMSRR---GVESR-RWNGRTKS-HVAPDVTLTSLEPIQ-------
Sb027814_Sorbi1 KSIVRELKEMRDGIGSMSRRGGSGSDGR-AGHGRSGSRHSWPSLWAEQQQPQRQGQEGPQ
Os009468_Os02t0 KSIVRELREMRDGIGSMSRR---AADGR-AGGGRGGSRHSWPVLWSEQQQPPQQQQLQRQ
pp000633_Pp1s10 KSLIREFQEMKGGIGNISRR---SFELKFPHHHRGRSSGMVLDESQLRPERVVE------
                :*::*::::::.*:*.:*:*                *                       

AT2G18280.1     -----QSPWASLPPELLHDIIWRVEESETAWPARAAVVSCASVCKSWRGITMEIVRIPEQ
pt037559_POPTR_ -----QGQWANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSWREITKEIVKTPEQ
Sm012016_Selmo1 -----QSRWASMPPELLRDVIQRLESSEHTWPARKNVVVCAEVCSQWRDIAKELVKTPEQ
gm030081_Glyma1 -----QGHWANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSWRAVTKEIVKTPEQ
Sb027814_Sorbi1 HQHQHQGRWANLPPELLLDVIQRVESSEATWPARRQVVACAAVCRSWREVTKEVVKTLEE
Os009468_Os02t0 EHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVTKEVVKTLEE
pp000633_Pp1s10 -----QSCWANMPPELLRDVIQRVEVSESTWPSRKHVVACAAVCSSWREITKELVRTPEQ
                     *. **.:***** *:* *:* ** :**:*  ** *. ** .** :: *:*:  *:

AT2G18280.1     CGKLTFPISLKQPGPRDSPIQCFIKRNRATATYILYYGLMPS----ETENDKLLLAARRI
pt037559_POPTR_ CGRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS----EGENDKLLLAARKI
Sm012016_Selmo1 SGKLTFPISLKQPGPRDATMQCFIKRDRATSTYHLCLGLSPNFDAGLQEHGKFLLAARKV
gm030081_Glyma1 CGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS----ENETDKLLLAAKKV
Sb027814_Sorbi1 CGRITFPISLKQPGPRDLPVQCFVRRERATSTYLLYLGLSPSM---NMENDKLLLAARKV
Os009468_Os02t0 CGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSL---HGENDKLLLAARKI
pp000633_Pp1s10 SGRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPS----LIENGKFLLAARKF
                .*::****:***** *: .:***::*:  *:*: *  ** *.      * .*:****::.

AT2G18280.1     RRATCTDFIISLSAKNFSRSSSTYVGKLRSGFLGTKFTIYDNQTASSTA-----QAQPNR
pt037559_POPTR_ RRATCSDFIVSLVSDDFSRASNTYVGKLRSNFLGTKFTMYDCEPTFEVPTQTQHANRISR
Sm012016_Selmo1 RRATTTDYIISLDPEDFSRGSTSYVGKLRSNFLGTKFTIYDSQPPHVGAMPSN--SRVGR
gm030081_Glyma1 RRATGTDFIISLVADDFSRSSNTYVGKLRSNFLGTKFTIYDSQPPHGAAIQPD--SQPSR
Sb027814_Sorbi1 RRATRTSFVISLVSDDFSHSSSTYVGKLKPNFLGTKFTIFDSQPPPDAVVLPN--NKPSK
Os009468_Os02t0 RRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPN--NRPSK
pp000633_Pp1s10 RRATSTDYIISLNQEDMSRGSNTYVGKLRSNFLGTKFTIYDSQPPHNRGVASN---RSSR
                **** :.:::**  .::* .*.:*****:..*******::* :..           : .:

AT2G18280.1     RLHPKQAAPKLPTNSSTVGNITYELNVLRTRGPRRMHCAMDSIPLSSV-----IAEPS-V
pt037559_POPTR_ RFHSRQVSPRLPACNYSIGTITYELNVLRSRGPRRMHCMMHSIPMSSIEEGGTVPTLTSL
Sm012016_Selmo1 RFGSKQISPRVPSGSYNVAHIAYELNVLGTRGPRRMQVTIHSIPASAMDPGGVAPTPTVF
gm030081_Glyma1 RFHSKQVSPRVPACNYVVSTIAYELNVLRARGPRRMHCTMNSIPVSAVQAGGNAPTPT-F
Sb027814_Sorbi1 R-QSKQVSPRLPLGNYNVATVTYELTVLRNRGPRRMQCTMHSIPAECIQEGGKAPTPTGT
Os009468_Os02t0 R-HFKQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCIQEGGKAPTPTGI
pp000633_Pp1s10 RIGSKQLTSRVHAGSYNVAHIAYELNVLGTRGPRRMQCMLHTIPMSAMESGGSAPTPTEF
                *   :* :.::   .  :. ::***.**  ******:  :.:**  .:      .  :  

AT2G18280.1     -VQGIEEEVSSS----PSPKGETITTD---KEIPDNSPSL-----RDQPLVLKNKSPRWH
pt037559_POPTR_ -TETFGGQFPHL----STSKGKESVSDISSPS-PSQSPV--LTQGSEEPLVLKNKAPRWH
Sm012016_Selmo1 -ANPLEDAQLPF------PVSKSKVSD--CSTAPVVVPYS-GVMSKDGPLVLKNKAPRWH
gm030081_Glyma1 -PEIIDEPFSPS----PALKGKGPIRDLDNASLPELLPV--ESQGSAEPLVLKNKAPRWH
Sb027814_Sorbi1 -IQSLDEPVSTS----PSTKGKEVALEFSSTSLSADLSGLALACANETPLVLKNKAPRWH
Os009468_Os02t0 -IHSLDEQVPAL----STSKGKEPAIEFSSTSLSADLSG--PVCTNEVPLVLKNKAPRWH
pp000633_Pp1s10 TASTLEDTHVAYSGILSSPRSRAAVVD--SSTLDCDF-VS-GPLTKDAPLILKNKAPRWH
                    :               ..    :                     **:****:****

AT2G18280.1     EQLQCWCLNFKGRVTVASVKNFQLVAEIDASLDAPPEEHERVILQFGKIGKDIFTMDYRY
pt037559_POPTR_ EQLQCWCLNFRGRVTVASVKNFQLVAAVESFHNVSSADQERVILQFGKIGKDIFTMDYRY
Sm012016_Selmo1 DQLQCWCLNFRGRVTVASVKNFQLVAALE-PGQQAHADHDKVLLQFGKIGKDMFTMDYRY
gm030081_Glyma1 EQLQCWCLNFKGRVTVASVKNFQLVSAVDPSHNVSAAEQEKVILQFGKIGKDIFTMDYRY
Sb027814_Sorbi1 EQLQCWCLNFRGRVTVASVKNFQLVASVDPSLNIPAAEQEKVILQFGKIGKDIFTMDYRY
Os009468_Os02t0 EQLQCWCLNFRGRVTVASVKNFQLVASVDPSLGIPAAEQEKVILQFGKIGKDIFTMDYRY
pp000633_Pp1s10 EQLQCWCLNFRGRVTVASVKNFQLVAATDLPPTNSQNDHDKVLLQFGKIGKDMFTMDYRY
                :*********:**************:  :     .  ::::*:*********:*******

AT2G18280.1     PLSAFQAFAICISSFDTKPACEG
pt037559_POPTR_ PLSAFQAFAICLSSFDTKPACE-
Sm012016_Selmo1 PLSAFQAFGICLSSFDTKLACE-
gm030081_Glyma1 PLSAFQAFAICLSSFDTKPACE-
Sb027814_Sorbi1 PLSAFQAFAICLTSFDTKPACE-
Os009468_Os02t0 PLSAFQAFAICLTSFDTKPACE-
pp000633_Pp1s10 PLSAFQAFAICLSSFDTKLACE-
                ********.**::***** *** 


BoxShade v3.31 C (beta, 970507) Output
AT2G18280.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
pt037559_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S I
Sm012016_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S S S S S S L L P L
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
Sb027814_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A A M S L
Os009468_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
pp000633_Pp1s10    M L A S E C L T V H G L R R W L K L W L I L L K R S L E G I W C E V S R R E L G F C K W T M S G Q K - - - S S S M M P L
 
AT2G18280.1     K S I L R D L K E V R D G L G G I S K R - - - - - - - - - - - - S W S K S S H I A P D Q T T P P L D N I P - - - - - - -
pt037559_POPTR_    K S I V R E L K E M K D G I G N I S R R - - - G L E G K - H W R G R A R S - H I A P D E T P A E T D Q I E - - - - - - -
Sm012016_Selmo1    R S I L R E F Q D I R D G I G S L S R R - - - S F E V R L P Y H H R S R S H S V V L D E P P V R D V V V L Q - - - - - -
gm030081_Glyma1    K S I V R E L K E M R D G I G S M S R R - - - G V E S R - R W N G R T K S - H V A P D V T L T S L E P I Q - - - - - - -
Sb027814_Sorbi1    K S I V R E L K E M R D G I G S M S R R G G S G S D G R - A G H G R S G S R H S W P S L W A E Q Q Q P Q R Q G Q E G P Q
Os009468_Os02t0    K S I V R E L R E M R D G I G S M S R R - - - A A D G R - A G G G R G G S R H S W P V L W S E Q Q Q P P Q Q Q Q L Q R Q
pp000633_Pp1s10    K S L I R E F Q E M K G G I G N I S R R - - - S F E L K F P H H H R G R S S G M V L D E S Q L R P E R V V E - - - - - -
 
AT2G18280.1     - - - - - Q S P W A S L P P E L L H D I I W R V E E S E T A W P A R A A V V S C A S V C K S W R G I T M E I V R I P E Q
pt037559_POPTR_    - - - - - Q G Q W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W R E I T K E I V K T P E Q
Sm012016_Selmo1    - - - - - Q S R W A S M P P E L L R D V I Q R L E S S E H T W P A R K N V V V C A E V C S Q W R D I A K E L V K T P E Q
gm030081_Glyma1    - - - - - Q G H W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W R A V T K E I V K T P E Q
Sb027814_Sorbi1    H Q H Q H Q G R W A N L P P E L L L D V I Q R V E S S E A T W P A R R Q V V A C A A V C R S W R E V T K E V V K T L E E
Os009468_Os02t0    E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T K E V V K T L E E
pp000633_Pp1s10    - - - - - Q S C W A N M P P E L L R D V I Q R V E V S E S T W P S R K H V V A C A A V C S S W R E I T K E L V R T P E Q
 
AT2G18280.1     C G K L T F P I S L K Q P G P R D S P I Q C F I K R N R A T A T Y I L Y Y G L M P S - - - - E T E N D K L L L A A R R I
pt037559_POPTR_    C G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S - - - - E G E N D K L L L A A R K I
Sm012016_Selmo1    S G K L T F P I S L K Q P G P R D A T M Q C F I K R D R A T S T Y H L C L G L S P N F D A G L Q E H G K F L L A A R K V
gm030081_Glyma1    C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - E N E T D K L L L A A K K V
Sb027814_Sorbi1    C G R I T F P I S L K Q P G P R D L P V Q C F V R R E R A T S T Y L L Y L G L S P S M - - - N M E N D K L L L A A R K V
Os009468_Os02t0    C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L - - - H G E N D K L L L A A R K I
pp000633_Pp1s10    S G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S - - - - L I E N G K F L L A A R K F
 
AT2G18280.1     R R A T C T D F I I S L S A K N F S R S S S T Y V G K L R S G F L G T K F T I Y D N Q T A S S T A - - - - - Q A Q P N R
pt037559_POPTR_    R R A T C S D F I V S L V S D D F S R A S N T Y V G K L R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A N R I S R
Sm012016_Selmo1    R R A T T T D Y I I S L D P E D F S R G S T S Y V G K L R S N F L G T K F T I Y D S Q P P H V G A M P S N - - S R V G R
gm030081_Glyma1    R R A T G T D F I I S L V A D D F S R S S N T Y V G K L R S N F L G T K F T I Y D S Q P P H G A A I Q P D - - S Q P S R
Sb027814_Sorbi1    R R A T R T S F V I S L V S D D F S H S S S T Y V G K L K P N F L G T K F T I F D S Q P P P D A V V L P N - - N K P S K
Os009468_Os02t0    R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N - - N R P S K
pp000633_Pp1s10    R R A T S T D Y I I S L N Q E D M S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H N R G V A S N - - - R S S R
 
AT2G18280.1     R L H P K Q A A P K L P T N S S T V G N I T Y E L N V L R T R G P R R M H C A M D S I P L S S V - - - - - I A E P S - V
pt037559_POPTR_    R F H S R Q V S P R L P A C N Y S I G T I T Y E L N V L R S R G P R R M H C M M H S I P M S S I E E G G T V P T L T S L
Sm012016_Selmo1    R F G S K Q I S P R V P S G S Y N V A H I A Y E L N V L G T R G P R R M Q V T I H S I P A S A M D P G G V A P T P T V F
gm030081_Glyma1    R F H S K Q V S P R V P A C N Y V V S T I A Y E L N V L R A R G P R R M H C T M N S I P V S A V Q A G G N A P T P T - F
Sb027814_Sorbi1    R - Q S K Q V S P R L P L G N Y N V A T V T Y E L T V L R N R G P R R M Q C T M H S I P A E C I Q E G G K A P T P T G T
Os009468_Os02t0    R - H F K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I Q E G G K A P T P T G I
pp000633_Pp1s10    R I G S K Q L T S R V H A G S Y N V A H I A Y E L N V L G T R G P R R M Q C M L H T I P M S A M E S G G S A P T P T E F
 
AT2G18280.1     - V Q G I E E E V S S S - - - - P S P K G E T I T T D - - - K E I P D N S P S L - - - - - R D Q P L V L K N K S P R W H
pt037559_POPTR_    - T E T F G G Q F P H L - - - - S T S K G K E S V S D I S S P S - P S Q S P V - - L T Q G S E E P L V L K N K A P R W H
Sm012016_Selmo1    - A N P L E D A Q L P F - - - - - - P V S K S K V S D - - C S T A P V V V P Y S - G V M S K D G P L V L K N K A P R W H
gm030081_Glyma1    - P E I I D E P F S P S - - - - P A L K G K G P I R D L D N A S L P E L L P V - - E S Q G S A E P L V L K N K A P R W H
Sb027814_Sorbi1    - I Q S L D E P V S T S - - - - P S T K G K E V A L E F S S T S L S A D L S G L A L A C A N E T P L V L K N K A P R W H
Os009468_Os02t0    - I H S L D E Q V P A L - - - - S T S K G K E P A I E F S S T S L S A D L S G - - P V C T N E V P L V L K N K A P R W H
pp000633_Pp1s10    T A S T L E D T H V A Y S G I L S S P R S R A A V V D - - S S T L D C D F - V S - G P L T K D A P L I L K N K A P R W H
 
AT2G18280.1     E Q L Q C W C L N F K G R V T V A S V K N F Q L V A E I D A S L D A P P E E H E R V I L Q F G K I G K D I F T M D Y R Y
pt037559_POPTR_    E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A V E S F H N V S S A D Q E R V I L Q F G K I G K D I F T M D Y R Y
Sm012016_Selmo1    D Q L Q C W C L N F R G R V T V A S V K N F Q L V A A L E - P G Q Q A H A D H D K V L L Q F G K I G K D M F T M D Y R Y
gm030081_Glyma1    E Q L Q C W C L N F K G R V T V A S V K N F Q L V S A V D P S H N V S A A E Q E K V I L Q F G K I G K D I F T M D Y R Y
Sb027814_Sorbi1    E Q L Q C W C L N F R G R V T V A S V K N F Q L V A S V D P S L N I P A A E Q E K V I L Q F G K I G K D I F T M D Y R Y
Os009468_Os02t0    E Q L Q C W C L N F R G R V T V A S V K N F Q L V A S V D P S L G I P A A E Q E K V I L Q F G K I G K D I F T M D Y R Y
pp000633_Pp1s10    E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A T D L P P T N S Q N D H D K V L L Q F G K I G K D M F T M D Y R Y
 
AT2G18280.1     P L S A F Q A F A I C I S S F D T K P A C E G
pt037559_POPTR_    P L S A F Q A F A I C L S S F D T K P A C E -
Sm012016_Selmo1    P L S A F Q A F G I C L S S F D T K L A C E -
gm030081_Glyma1    P L S A F Q A F A I C L S S F D T K P A C E -
Sb027814_Sorbi1    P L S A F Q A F A I C L T S F D T K P A C E -
Os009468_Os02t0    P L S A F Q A F A I C L T S F D T K P A C E -
pp000633_Pp1s10    P L S A F Q A F A I C L S S F D T K L A C E -
 
0