fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT2G18280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os009468 not found in 428aa AT2G18280.2 1st_not 0.549071618 II
Os009471 not found in 416aa AT2G18280.2 not_not 0.526525198 III
Os021774 not found in 445aa AT1G25280.1 not_not 0.497347480 III
Os021773 not found in 445aa AT1G25280.1 not_not 0.497347480 III
Os040209 not found in 445aa AT1G25280.1 not_not 0.492042440 III
Os029490 not found in 406aa AT2G47900.2 not_not 0.490716180 III
Os029491 not found in 406aa AT2G47900.2 not_not 0.490716180 III
Os029803 not found in 451aa AT1G25280.1 not_not 0.486737400 III
Os004869 not found in 448aa AT1G25280.1 not_not 0.468169761 III
Os019651 not found in 462aa AT1G25280.1 not_not 0.466843501 III
Os019649 not found in 462aa AT1G25280.1 not_not 0.466843501 III
Sb027814 not found in 706aa AT2G18280.2 1st_not 0.567639257 II
Sb032660 ACQGAALRLSLAFLDS in 197/692 AT1G25280.1 not_not 0.488063660 III
SPLIMGLSLMLAGQAE in 382/692
Sb028483 VSVFVELKLTLSSSSS in 564/671 AT1G76900.2 not_not 0.462864721 III
Sb024300 not found in 556aa AT2G47900.2 not_not 0.408488063 III
Gm030081 not found in 414aa AT2G18280.2 1st_not 0.644562334 II
Gm030080 not found in 414aa AT2G18280.2 not_not 0.644562334 III
Gm001764 not found in 415aa AT2G18280.2 not_not 0.623342175 III
Gm003133 not found in 414aa AT2G18280.2 not_not 0.612732095 III
Gm044675 not found in 414aa AT2G18280.2 not_not 0.611405835 III
Gm039266 not found in 423aa AT1G47270.1 not_not 0.538461538 III
Gm039265 not found in 423aa AT1G47270.1 not_not 0.538461538 III
Gm044960 not found in 424aa AT1G25280.1 not_not 0.530503978 III
Gm044959 not found in 424aa AT1G25280.1 not_not 0.530503978 III
Gm041219 not found in 427aa AT1G25280.1 not_not 0.519893899 III
Gm003397 not found in 424aa AT1G25280.1 not_not 0.517241379 III
Gm003395 not found in 424aa AT1G25280.1 not_not 0.517241379 III
Gm028527 not found in 430aa AT1G25280.1 not_not 0.514588859 III
Gm028526 not found in 430aa AT1G25280.1 not_not 0.514588859 III
Gm021743 not found in 427aa AT1G25280.1 not_not 0.511936339 III
Gm021742 not found in 427aa AT1G25280.1 not_not 0.511936339 III
Gm021741 not found in 427aa AT1G25280.1 not_not 0.511936339 III
Gm021740 not found in 427aa AT1G25280.1 not_not 0.511936339 III
Gm054929 not found in 430aa AT1G25280.1 not_not 0.503978779 III
Gm054928 not found in 430aa AT1G25280.1 not_not 0.503978779 III
Gm041730 not found in 385aa AT2G47900.2 not_not 0.493368700 III
Gm036751 not found in 389aa AT2G47900.2 not_not 0.492042440 III
Gm004126 not found in 400aa AT2G47900.2 not_not 0.485411140 III
Gm048089 not found in 410aa AT1G47270.1 not_not 0.481432360 III
Gm019438 not found in 359aa AT2G47900.2 not_not 0.435013262 III
Gm045746 not found in 362aa AT2G47900.2 not_not 0.435013262 III
Gm045745 not found in 362aa AT2G47900.2 not_not 0.435013262 III
Gm003396 not found in 407aa AT1G25280.1 not_not 0.432360742 III
Gm037352 not found in 381aa AT1G53320.1 not_not 0.431034482 III
Gm034540 not found in 378aa AT1G53320.1 not_not 0.423076923 III
Gm045744 not found in 392aa AT2G47900.2 not_not 0.413793103 III
Pt037559 not found in 416aa AT2G18280.2 1st_not 0.620689655 II
Pt037558 not found in 416aa AT2G18280.2 not_not 0.620689655 III
Pt001281 not found in 414aa AT2G18280.2 not_not 0.602122015 III
Pt037730 not found in 416aa AT1G47270.1 not_not 0.539787798 III
Pt000712 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt000711 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt000710 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt000709 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt002868 not found in 423aa AT1G25280.1 not_not 0.523872679 III
Pt001717 not found in 416aa AT1G47270.1 not_not 0.522546419 III
Pt039357 not found in 424aa AT1G76900.2 not_not 0.511936339 III
Pt041132 not found in 392aa AT2G47900.2 not_not 0.486737400 III
Pt034249 not found in 395aa AT2G47900.2 not_not 0.478779840 III
Pt028965 not found in 377aa AT1G53320.1 not_not 0.404509283 III
Pp000633 not found in 474aa AT2G47900.2 1st_not 0.531830238 II
Pp034735 not found in 483aa AT2G47900.2 not_not 0.522546419 III
Pp034734 not found in 483aa AT2G47900.2 not_not 0.522546419 III
Pp022942 not found in 447aa AT2G47900.2 not_not 0.519893899 III
Pp034759 not found in 428aa AT2G47900.2 not_not 0.513262599 III
Pp005711 not found in 407aa AT2G47900.2 not_not 0.505305039 III
Pp022947 not found in 435aa AT2G47900.2 not_not 0.502652519 III
Sm012016 ATSTYHLCLGLSPNFD in 155/430 AT2G47900.2 1st_not 0.521220159 II
Sm008088 not found in 357aa AT2G47900.2 not_not 0.486737400 III
Sm016835 not found in 432aa AT2G47900.2 not_not 0.481432360 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (1 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT2G18280.1     ---------------------------------------------------------MSL
gm021742_Glyma0 ---------------------------------------------------------MSF
Sm012016_Selmo1 ---------------------------------------------MSGKKSSSSSSLLPL
gm021743_Glyma0 ---------------------------------------------------------MSF
Os021774_Os05t0 ---------------------------------------------------------MSF
pt000712_POPTR_ ---------------------------------------------------------MSF
gm041219_Glyma1 ---------------------------------------------------------MSF
Os021773_Os05t0 ---------------------------------------------------------MSF
Os029490_Os07t0 ---------------------------------------------------------MSF
pp034759_Pp1s15 ---------------------------------------------------------MPL
gm045744_Glyma1 --------------------------------------------------------MIEV
Os029803_Os08t0 ---------------------------------------------------------MSF
gm003397_Glyma0 ---------------------------------------------------------MSF
Os009468_Os02t0 ---------------------------------------------------------MSL
pp000633_Pp1s10 MLASECLTVHGLRRWLKLWLILLKRSLEGIWCEVSRRELGFCKWTMSGQKS---SSMMPL
pt001717_POPTR_ ---------------------------------------------------------MSF
Sb028483_Sorbi1 ---------------------------------------------------------MSF
gm044960_Glyma1 ---------------------------------------------------------MSF
pt041132_POPTR_ --------------------------------------------------------MSAI
gm054929_Glyma2 ---------------------------------------------------------MSF
Os004869_Os01t0 ---------------------------------------------------------MSF
gm030081_Glyma1 ---------------------------------------------------------MSL
gm048089_Glyma1 ---------------------------------------------------------MPF
Os019649_Os04t0 ---------------------------------------------------------MSF
Sb027814_Sorbi1 -------------------------------------------------------AAMSL
pp034735_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRS--GSSMMPL
gm039265_Glyma1 ---------------------------------------------------------MPF
pt034249_POPTR_ --------------------------------------------------------MPAL
Sb024300_Sorbi1 --AEEC------------------------SCGGGG---GF--WRVGGRER-QASGDMPF
gm054928_Glyma2 ---------------------------------------------------------MSF
Sb032660_Sorbi1 ------------------------------------------------------LAKMSF
gm021740_Glyma0 ---------------------------------------------------------MSF
gm041730_Glyma1 --------------------------------------------------------MCLI
gm045746_Glyma1 --------------------------------------------------------MIEV
gm003396_Glyma0 ---------------------------------------------------------MSF
gm044959_Glyma1 ---------------------------------------------------------MSF
gm004126_Glyma0 ---------------------------------------------------------MSF
pt000710_POPTR_ ---------------------------------------------------------MSF
pp034734_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRS--GSSMMPL
pp022942_Pp1s22 ---------------------------------------------------------MPL
gm021741_Glyma0 ---------------------------------------------------------MSF
gm036751_Glyma1 --------------------------------------------------------MGLI
Sm016835_Selmo1 ---------------------------------------------MSGKKS---STLTPL
gm028526_Glyma1 ---------------------------------------------------------MSF
pp022947_Pp1s22 ------------------------------------------------------------
pt000711_POPTR_ ---------------------------------------------------------MSF
pt037558_POPTR_ ---------------------------------------------------------MSI
gm037352_Glyma1 ---------------------------------------------------------MSL
gm019438_Glyma0 ------------------------------------------------------------
pt039357_POPTR_ ---------------------------------------------------------MSF
pt037730_POPTR_ ---------------------------------------------------------MSF
gm030080_Glyma1 ---------------------------------------------------------MSL
Os019651_Os04t0 ---------------------------------------------------------MSF
pt028965_POPTR_ ---------------------------------------------------------MSL
pt000709_POPTR_ ---------------------------------------------------------MSF
pt037559_POPTR_ ---------------------------------------------------------MSI
gm003395_Glyma0 ---------------------------------------------------------MSF
gm045745_Glyma1 --------------------------------------------------------MIEV
gm028527_Glyma1 ---------------------------------------------------------MSF
Os009471_Os02t0 ------------------------------------------------------------
pt002868_POPTR_ ---------------------------------------------------------MSF
gm039266_Glyma1 ---------------------------------------------------------MPF
pp005711_Pp1s21 ------------------------------------------------------------
gm003133_Glyma0 ---------------------------------------------------------MSL
gm034540_Glyma1 ---------------------------------------------------------MSL
gm044675_Glyma1 ---------------------------------------------------------MSL
Sm008088_Selmo1 ------------------------------------------------------------
gm001764_Glyma0 ---------------------------------------------------------MSL
pt001281_POPTR_ ---------------------------------------------------------MSF
Os029491_Os07t0 ---------------------------------------------------------MSF
Os040209_Os12t0 ---------------------------------------------------------MSF
                                                                            

AT2G18280.1     KSILRDLKEVRDGLGGISKR-------------------SWSKSSHI--APDQTTPPLDN
gm021742_Glyma0 RSIV---RDVRDSFGSLSRR---SFDVR-------LTGHHRGKSQGS--VQDLHDQPL--
Sm012016_Selmo1 RSILREFQDIRDGIGSLSRR---SFEVR-------LPYHHRSRSHSV--VLD--------
gm021743_Glyma0 RSIV---RDVRDSFGSLSRR---SFDVR-------LTGHHRGKSQGS--VQDLHDQPL--
Os021774_Os05t0 RSIV---RDVRDSFGSLSRR---SFEVTLAGL-SGLTGHHRGKSQST--VHELCDADL--
pt000712_POPTR_ RSIV---RDMRDGFGSLSRR---SFEVR-------LPGHFRGKSHGS--ACELLDQPV--
gm041219_Glyma1 RSIV---RDVRDSFGSLSRR---SFDVR-------LTGHHRGKSQGS--VQDLHDQPL--
Os021773_Os05t0 RSIV---RDVRDSFGSLSRR---SFEVTLAGL-SGLTGHHRGKSQST--VHELCDADL--
Os029490_Os07t0 RSVI---QEVKGEIGAISRR---GF---------------RSRPGRVRRVAAAAEEPP--
pp034759_Pp1s15 KSLIREFQEMKGGRGGISRR---SFELK-------FPHHHKGRSSGM--VLD--------
gm045744_Glyma1 QAN---------------------------------------------------------
Os029803_Os08t0 RSIV---RDVRDSFGSLSRR---SFEVRISGL-PGLSGHHRGKSLGS--LSELRDRPV--
gm003397_Glyma0 RSIV---RDVRDGFGSLSRR---SFDVR-------ISGG--GKLNSL--VHEAHERQL--
Os009468_Os02t0 KSIVRELREMRDGIGSMSRR---AADGR--------AGGGRGGSRHS--WPVLWSEQQQP
pp000633_Pp1s10 KSLIREFQEMKGGIGNISRR---SFELK-------FPHHHRGRSSGM--VLD--------
pt001717_POPTR_ KS---KLKEIRDDITTTFSMG--KLQRN--------RTNRRGRA-YI--APEL-------
Sb028483_Sorbi1 RSIV---RDVRDGFGSLSRR---GFEVR-------FLSPRRGKSHGA--VHELHDPVP--
gm044960_Glyma1 RSIV---RDVRDGFGSLSRR---SFDVR-------LSGG--GKSNSL--VHEEHECLP--
pt041132_POPTR_ KSII-----------------------------------NRSRSHR---VVQYSSAPD--
gm054929_Glyma2 RSIV---RDVRDGFGSLSRR---SFEVR-------LPGHNRGKSRSS--VHELQDQPP--
Os004869_Os01t0 RSIV---RDVRDGFGSLSRR---SFEVTLASL-YGLTGHHKGKTQSS--LDELDDSPA--
gm030081_Glyma1 KSIVRELKEMRDGIGSMSRR---GVESR--------RWNGRTKS-HV--APDVTLTSLEP
gm048089_Glyma1 RSIVRELKEIGEGISNMYRR---GGEAK--------HVHRHGKS-HI--APECSLPPPPS
Os019649_Os04t0 RSIV---RDFRDSFGTLSKR---SFEVKIS----GFSGRHRGKSIGP--SSELDDTPV--
Sb027814_Sorbi1 KSIVRELKEMRDGIGSMSRRGGSGSDGR--------AGHGRSGSRHS--WPSLWAEQQQP
pp034735_Pp1s15 KSLIREFQEMKGGRGGISRR---SFELK-------FPHHHKGRSSGM--VLD--------
gm039265_Glyma1 RSIVRELKEIGEGISNMYRR---GGEAK--------HVHRHGKS-HI--APECSLPPPPP
pt034249_POPTR_ KSII-----------------------------------NRSTSHR---VVQYSSAPE--
Sb024300_Sorbi1 SSMI---HEMKGEIGAISSR---GL--------------LRFRSGGH--AAAAGRA----
gm054928_Glyma2 RSIV---RDVRDGFGSLSRR---SFEVR-------LPGHNRGKSRSS--VHELQDQPP--
Sb032660_Sorbi1 RSIV---RDVRDSFGSLSRR---SFEVTIAGL-SGLTVHHRGKSQST--VHEVCDTDL--
gm021740_Glyma0 RSIV---RDVRDSFGSLSRR---SFDVR-------LTGHHRGKSQGS--VQDLHDQPL--
gm041730_Glyma1 RSM-------------------------------------RSQSQR---VVQEQEEAE--
gm045746_Glyma1 QAN---------------------------------------------------------
gm003396_Glyma0 RSIV---RDVRDGFGSLSRR---SFDVR-------ISGG--GKLNSL--VHEAHERQL--
gm044959_Glyma1 RSIV---RDVRDGFGSLSRR---SFDVR-------LSGG--GKSNSL--VHEEHECLP--
gm004126_Glyma0 RSII---LE---------RK---GFEVK-------FGYSMRSRSQ------SHSDAIA--
pt000710_POPTR_ RSIV---RDMRDGFGSLSRR---SFEVR-------LPGHFRGKSHGS--ACELLDQPV--
pp034734_Pp1s15 KSLIREFQEMKGGRGGISRR---SFELK-------FPHHHKGRSSGM--VLD--------
pp022942_Pp1s22 KSLIREFQEMKGGIGNISRR---SFELK-------FPHHHKGRSSGM--VLD--------
gm021741_Glyma0 RSIV---RDVRDSFGSLSRR---SFDVR-------LTGHHRGKSQGS--VQDLHDQPL--
gm036751_Glyma1 RSM-------------------------------------RSRSQR---VVQEQEAAE--
Sm016835_Selmo1 WSVI---QDIK-GIGSISRR---SFEVK-------LPTYSRSRSHSA--AQDAAGRHQF-
gm028526_Glyma1 RSIV---REVRDGFGSLSRR---SFEVR-------LPGHNRGKSRSL--VHELQDQPP--
pp022947_Pp1s22 ---------MKGGIGNISRR---SFELK-------FPHHHKGRSSGM--VLD--------
pt000711_POPTR_ RSIV---RDMRDGFGSLSRR---SFEVR-------LPGHFRGKSHGS--ACELLDQPV--
pt037558_POPTR_ KSIVRELKEMKDGIGNISRR---GLEGK--------HWRGRARS-HI--APDETPAETDQ
gm037352_Glyma1 RKVF------------RSRKFSRSFKEVLPAEGAAIVGGEDG-VAGA--GEESSNG-N--
gm019438_Glyma0 ------------------------------------------------------------
pt039357_POPTR_ RSIV---RDMRDGFGSLSRR---SFEVR-------LPGHLRGKSHGS--ACELQDQPV--
pt037730_POPTR_ KG---KLKEIRDDISTTFSMG--KLQRN--------RTNRRGRA-YI--APEL-------
gm030080_Glyma1 KSIVRELKEMRDGIGSMSRR---GVESR--------RWNGRTKS-HV--APDVTLTSLEP
Os019651_Os04t0 RSIV---RDFRDSFGTLSKR---SFEVKIS----GFSGRHRGKSIGP--SSELDDTPV--
pt028965_POPTR_ RRSF------------LSRRFSRSFNNQNRNERNGV---ESGRLVG------ESGGES--
pt000709_POPTR_ RSIV---RDMRDGFGSLSRR---SFEVR-------LPGHFRGKSHGS--ACELLDQPV--
pt037559_POPTR_ KSIVRELKEMKDGIGNISRR---GLEGK--------HWRGRARS-HI--APDETPAETDQ
gm003395_Glyma0 RSIV---RDVRDGFGSLSRR---SFDVR-------ISGG--GKLNSL--VHEAHERQL--
gm045745_Glyma1 QAN---------------------------------------------------------
gm028527_Glyma1 RSIV---REVRDGFGSLSRR---SFEVR-------LPGHNRGKSRSL--VHELQDQPP--
Os009471_Os02t0 ---------MRDGIGSMSRR---AADGR--------AGGGRGGSRHS--WPVLWSEQQQP
pt002868_POPTR_ RSIV---RDMRDGFGSLSRR---SFEVR-------LPGHHRGKSHSS--ACELHDQPV--
gm039266_Glyma1 RSIVRELKEIGEGISNMYRR---GGEAK--------HVHRHGKS-HI--APECSLPPPPP
pp005711_Pp1s21 ---------MKSGVGRISRR---SFELK-------FPHHHRGRSSGM--VLD--------
gm003133_Glyma0 RSIVRELKEMRDGIGSTSKR---GAESK--------HRLSRTKS-HV--APDVLATPFEP
gm034540_Glyma1 RKVF------------RSRKFSKSFKEVLPAEGAAV---EGG-VAGT--VEEAANGNN--
gm044675_Glyma1 RSIVRELKEMRDGIGSTSKR---GAESK--------HWLSRTKS-HV--APDILATPFEP
Sm008088_Selmo1 ----------------MSR-----------------------------------------
gm001764_Glyma0 KSIVRELKEMRDGIGSMSRR---GVESR--------RWNGRTKS-HV--APDVILTSLEP
pt001281_POPTR_ KSIMREFKEIKEGIGSISRR---GVEGK--------HWCGRVRS-HI--APDETREETDQ
Os029491_Os07t0 RSVI---QEVKGEIGAISRR---GF---------------RSRPGRVRRVAAAAEEPP--
Os040209_Os12t0 RSIV---RDVRDGFGSLSRR---GFEVR-------LVGHRRGRSHSA--VHELRDGHAA-
                                                                            

AT2G18280.1     IPQSP------------WASLPPELLHDIIWRVEESETAWPARAAVVSCASVCKSW-RGI
gm021742_Glyma0 ----------VIQN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNM
Sm012016_Selmo1 --EPPVRDVVVLQQ-SRWASMPPELLRDVIQRLESSEHTWPARKNVVVCAEVCSQW-RDI
gm021743_Glyma0 ----------VIQN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNM
Os021774_Os05t0 ----------IIQE-SRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAW-REM
pt000712_POPTR_ ----------VIQD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REM
gm041219_Glyma1 ----------VIQN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNM
Os021773_Os05t0 ----------IIQE-SRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAW-REM
Os029490_Os07t0 --DESSAAALVMRE-SCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSW-RGI
pp034759_Pp1s15 --ESQLRVEAVVKQ-SCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSW-REI
gm045744_Glyma1 ----------AMEQ-SWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLI
Os029803_Os08t0 ----------VVDQ-SRWVGLPPELLRDVMKRLEEGESNWPSRKDVVACAAVCRTW-REI
gm003397_Glyma0 ----------VIQN-SRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REM
Os009468_Os02t0 PQQQQLQRQEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSW-REV
pp000633_Pp1s10 --ESQLRPERVVEQ-SCWANMPPELLRDVIQRVEVSESTWPSRKHVVACAAVCSSW-REI
pt001717_POPTR_ -GGGSELLSELIEEQSPWANLPPELLQDVIKRVEGSETSWPGRRDVVACASVCTSW-REI
Sb028483_Sorbi1 ----------VVQS-SCWASLPPELLRDVIERLETSEDTWPSRKHVVACAAVCRTW-REM
gm044960_Glyma1 ----------VVQN-SRWASLPPELLRDVIKRLEESETTWPARKHVVACAAVCRSW-RGM
pt041132_POPTR_ --LSLFGGGCGAETTSCWANLPQELLREVLIRIEESESSWPPRKNVVACAGVCRSW-RDI
gm054929_Glyma2 ----------VIQN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REM
Os004869_Os01t0 ----------IIPE-SRWASLPPELLREVIRRLEADESTWPSRRNVVCFAAVCRTW-REM
gm030081_Glyma1 IQQGH------------WANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAV
gm048089_Glyma1 SSSSSSSSS---SWQSRWANLPPELLLDIIQRLEASETSWPARRALVACASVCKLW-REI
Os019649_Os04t0 ----------VAQQ-SKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTW-RDM
Sb027814_Sorbi1 QRQGQEGPQHQHQHQGRWANLPPELLLDVIQRVESSEATWPARRQVVACAAVCRSW-REV
pp034735_Pp1s15 --ESQLRVEAVVKQ-SCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSW-REI
gm039265_Glyma1 PPPSSSS-------QSRWANLPPELLLDIIQRLEASETSWPARRALVACASVCRLW-REI
pt034249_POPTR_ --LNLFAAGGAAETASCWANLPQELLREVLVRIEESESSWPPRKNVVACAGVCRSW-RHI
Sb024300_Sorbi1 --SAAAEPDEALRE-SCWARVPPELLRMVLARVEHEEARWPGRSAVVASAGVCRCW-RAV
gm054928_Glyma2 ----------VIQN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REM
Sb032660_Sorbi1 ----------IIQE-SRWANLPPELLRDVIRRLEASESTWPNRKHVVSCAAVCRAW-REM
gm021740_Glyma0 ----------VIQN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNM
gm041730_Glyma1 --C----VGDSMRQ-SCWANMPQELLREVLFRIEASEDAWPPRKSVVACAGVCRSW-RQI
gm045746_Glyma1 ----------AMEQ-SWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLI
gm003396_Glyma0 ----------VIQN-SRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REM
gm044959_Glyma1 ----------VVQN-SRWASLPPELLRDVIKRLEESETTWPARKHVVACAAVCRSW-RGM
gm004126_Glyma0 --QDSLVVLDGLKQ-SCWANMPPELLRDVLMRIEASEDSWPAQKHVVACAGVCRSW-REI
pt000710_POPTR_ ----------VIQD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REM
pp034734_Pp1s15 --ESQLRVEAVVKQ-SCWANMPPELLRDVIQRVEASESAWPGRKHVVACAAVCSSW-REI
pp022942_Pp1s22 --ESQLRAEPVVEQ-SCWANMPPELLRDVIQRVEASENAWPSRKHVVACAAVCSSW-REI
gm021741_Glyma0 ----------VIQN-SRWASLPPELLFDIIRRLEESENTWPARKHVVACAAVCQSW-RNM
gm036751_Glyma1 --CVGVVVGDSMRQ-SCWANMPQELLREVLLRIEASEDTWPPRKSVVSCAGVCRSW-RHI
Sm016835_Selmo1 -GESG-------QQ-SRWANMPPELLRDVIQRVEASDKMWPSRKSVVACAAVCRNW-RKI
gm028526_Glyma1 ----------VIQN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REM
pp022947_Pp1s22 --ESQLRAEPVVEQ-SCWANMPPELLRDVIQRVEASENAWPSRKHVVACAAVCSSW-REI
pt000711_POPTR_ ----------VIQD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REM
pt037558_POPTR_ IEQGQ------------WANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSW-REI
gm037352_Glyma1 ---------------NGWSNMLPEILGEIVRRVDAAEEQWPNRQNVVACACVCKRW-RDI
gm019438_Glyma0 -----------MEQ-SWRANMPRELLREVLLRIESSEATWPSRRSVVACGGVCRTW-RLI
pt039357_POPTR_ ----------VIQN-SRWAGLPPELLQDVIKRLEASESTWPSRKHVVACASVCRAW-REM
pt037730_POPTR_ -GGGSELFRELIEEQSPWANLPPELLHDVIQRVEGSETSWPGRRDVVACASVCKSW-REI
gm030080_Glyma1 IQQGH------------WANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAV
Os019651_Os04t0 ----------VAQQ-SKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTW-RDM
pt028965_POPTR_ ---------------DGWGSMLPELLGEIIKRVEESEDRWPQRQNVVACACVCKKW-REV
pt000709_POPTR_ ----------VIQD-SPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAW-REM
pt037559_POPTR_ IEQGQ------------WANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSW-REI
gm003395_Glyma0 ----------VIQN-SRWASLPPELLCDVIKRLEESESTWPARKHVVACAAVCKSW-REM
gm045745_Glyma1 ----------AMEQ-SWWANMPHELLREVLLRIESSESTWPLRRSVVACGGVCRTWRRLI
gm028527_Glyma1 ----------VIQN-SRWASLPPELLRDVINRLEASESTWPGRKHVVACAAVCKSW-REM
Os009471_Os02t0 PQQQQLQRQEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSW-REV
pt002868_POPTR_ ----------VIQN-SRWAGLPPELLRDVIKRLEASESTWPARKHVVACAAVCSAW-REM
gm039266_Glyma1 PPPSSSS-------QSRWANLPPELLLDIIQRLEASETSWPARRALVACASVCRLW-REI
pp005711_Pp1s21 --ESQLNSEPVVEQ-SCWANMPPELLRDVIQRVEASESAWPSRKHVVACAAVCSSW-REV
gm003133_Glyma0 IQQGQ------------WANLPSELLLDIIQRVEESETSWPARAVVVFCASVCKSW-RSI
gm034540_Glyma1 ---------------NGWSSMLPEILGEIVRRVDAAEEQWPNRQNVVACACVCKRW-RDI
gm044675_Glyma1 IQQGQ------------WANLPSELLLDIIQRIEESETSWPARAVVVFCASVCKSW-RSI
Sm008088_Selmo1 -------------Q-SCWANMPPELLRDIIQRLESSDNVWPSRKNVVACAAVCSTW-REI
gm001764_Glyma0 IQQGQ------------WANLPPELLLDIIRRVEDSETTWPARAVVVYCGSVCKSW-RAV
pt001281_POPTR_ IDQGQ------------WANLPPELLLDIIMRLEESESSWPARVVVVHCASVCRSW-REI
Os029491_Os07t0 --DESSAAALVMRE-SCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSW-RGI
Os040209_Os12t0 -----AAAADVVQS-SCWANLPPELLRDVIERLEASEAAWPSRKNVVACAAVCRTW-RDM
                                    :  *:*  :: *::  :  ** :  :*  . **  * * :

AT2G18280.1     TMEIVR-IPEQ------CGKLTFPISLKQPGPRDSPIQCFIKRNRATATYILYYGLMPS-
gm021742_Glyma0 CKDIVK-SPEF------CGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA-
Sm012016_Selmo1 AKELVK-TPEQ------SGKLTFPISLKQPGPRDATMQCFIKRDRATSTYHLCLGLSPNF
gm021743_Glyma0 CKDIVK-SPEF------CGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA-
Os021774_Os05t0 CKEIVL-SPEF------CGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTA-
pt000712_POPTR_ CKEIVR-SPEF------SGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA-
gm041219_Glyma1 CKDIVK-SPEF------CGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA-
Os021773_Os05t0 CKEIVL-SPEF------CGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTA-
Os029490_Os07t0 VREIVR-TPEA------SGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-
pp034759_Pp1s15 TKELVR-TPEQ------SGRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPT-
gm045744_Glyma1 VKEIVK-PPQF------SSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSA-
Os029803_Os08t0 CKDIVQ-SPEI------CGKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPA-
gm003397_Glyma0 CKEIVT-SPEF------CGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA-
Os009468_Os02t0 TKEVVK-TLEE------CGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPS-
pp000633_Pp1s10 TKELVR-TPEQ------SGRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPS-
pt001717_POPTR_ TKAVVK-TPEQ------CGCITFPISLKQPGPRDAPIQCFIKRERATSTYHLYLGLSPA-
Sb028483_Sorbi1 CREIVK-SPEV------SGKITFPVSLKQPGPRDGTIQCFIKRDKSTQVYSLYLSFSSA-
gm044960_Glyma1 CKEIVT-SPEF------CGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA-
pt041132_POPTR_ TKELVK-VPEL------SGKLTFPISVKQPGPRDFLLQCFIKRCRSAQTYRLYLGLNNA-
gm054929_Glyma2 CKEIVS-SPEF------CGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPA-
Os004869_Os01t0 CKETVL-SPEF------CGKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNV-
gm030081_Glyma1 TKEIVK-TPEQ------CGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-
gm048089_Glyma1 TKDVVK-TPEQ------CGFITFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPA-
Os019649_Os04t0 CKDIVR-NPEF------CGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSA-
Sb027814_Sorbi1 TKEVVK-TLEE------CGRITFPISLKQPGPRDLPVQCFVRRERATSTYLLYLGLSPS-
pp034735_Pp1s15 TKELVR-TPEQ------SGRLTFPIALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPS-
gm039265_Glyma1 TKDVIK-TPEQ------CGLLTFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPA-
pt034249_POPTR_ TKDLVK-VPEL------SGKITFPISVKQPGPREQLLQCFIKRCRSTQTYRLYLSLNNA-
Sb024300_Sorbi1 VKEMVR-VPEV------SGKITFPISLKQPGPRDAPMKCFIRRNRATQSYSLCIGITDA-
gm054928_Glyma2 CKEIVS-SPEF------CGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPA-
Sb032660_Sorbi1 CREIVL-SPEF------CGKLTFPVSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTA-
gm021740_Glyma0 CKDIVK-SPEF------CGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA-
gm041730_Glyma1 TIDIVK-TPEL------SSKITFPISVKQPGPRENLLRCFIKRNRSSQTYYLYLSLTNT-
gm045746_Glyma1 VKEIVK-PPQF------SSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSA-
gm003396_Glyma0 CKEIVT-SPEF------CGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA-
gm044959_Glyma1 CKEIVT-SPEF------CGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA-
gm004126_Glyma0 MKEIVK-SPQL------SGKLTFPISLKQPGPRDSLLQCYIKRNRSNQTYYLFLGLNQA-
pt000710_POPTR_ CKEIVR-SPEF------SGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA-
pp034734_Pp1s15 TKELVR-TPEQ------SGRLTFPIALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPS-
pp022942_Pp1s22 TKELVR-TPEQ------SGRLTFPIALKQPGPRDSTMQCFIKRDRTTSTYQLFLGLPPS-
gm021741_Glyma0 CKDIVK-SPEF------CGKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA-
gm036751_Glyma1 TKDIVK-TPEL------SSKITFPISVKQPGPRENLLRCFIKRNRSTQTYYLFLSLTST-
Sm016835_Selmo1 TKEIVQ-TLEQ------CGRLTFPVSLKQPGPRDATVQCYLKRDRTTSTYYLYLGITPS-
gm028526_Glyma1 CKEIVS-SPEF------CGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLGLSPA-
pp022947_Pp1s22 TKELVR-TPEQ------SGRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPS-
pt000711_POPTR_ CKEIVR-SPEF------SGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA-
pt037558_POPTR_ TKEIVK-TPEQ------CGRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-
gm037352_Glyma1 TREVVR-VPSH------TGKITFPACLKQPGPRDVPHQCLIKRNKKTSTFYLYLALTPSF
gm019438_Glyma0 VKEIVK-PPQL------SSNITFPISLKQPGPREHLLQCFIRRNSATQTYYLFLSLSSA-
pt039357_POPTR_ CKEIVR-SPEF------SGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA-
pt037730_POPTR_ TKTVVK-TPEQ------CGCITFPISLKQPGPRDAPIQCFIKRERATSTYLLYLGLSPA-
gm030080_Glyma1 TKEIVK-TPEQ------CGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-
Os019651_Os04t0 CKDIVR-NPEF------CGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSA-
pt028965_POPTR_ TKDIVKSLPNNNNNNGSSGKITFPSCLKQPGPRDLPHQCLIKRNKKTSTFYLYLALTPSF
pt000709_POPTR_ CKEIVR-SPEF------SGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA-
pt037559_POPTR_ TKEIVK-TPEQ------CGRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-
gm003395_Glyma0 CKEIVT-SPEF------CGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA-
gm045745_Glyma1 VKEIVK-PPQF------SSNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSA-
gm028527_Glyma1 CKEIVS-SPEF------CGKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLGLSPA-
Os009471_Os02t0 TKEVVK-TLEE------CGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPS-
pt002868_POPTR_ CKEIVR-NPEF------SGKITFPVSLKQPGPRDGTIQCFIKRDKSKLTYHLFLCLSPA-
gm039266_Glyma1 TKDVIK-TPEQ------CGLLTFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPA-
pp005711_Pp1s21 TKELVR-APEQ------SGRLTFPVALKQPGPREDTVQCFIKRDRTTSTYQLFLGLPPS-
gm003133_Glyma0 TREIVK-TPEQ------CGRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLYFGLVPS-
gm034540_Glyma1 TREVVR-VPSH------TGKITFPSCLKQPGPRDVPHQCLIKRNQKTSTFYLYLALTPSF
gm044675_Glyma1 TREIVK-TPEQ------CGRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLYFGLVPS-
Sm008088_Selmo1 TKELVK-SPEL------SGKLTFPVSLKQPGPRDATVQCYIERDRTTATYRLFLGLTPT-
gm001764_Glyma0 TKEIVK-TPEQ------CGRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-
pt001281_POPTR_ TKEIVK-TPEQ------CGRLTFPISLKQPGPRESPIQCFIKRDNATSTFLLYYGLVPS-
Os029491_Os07t0 VREIVR-TPEA------SGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-
Os040209_Os12t0 CREIVK-NPEF------CGKITFPVSLKQPGPRNGAIQCFIKRDKSTQTYNLYLCLSSA-
                    :    .        . :*** .:**** *:   :* : *      : *   :    

AT2G18280.1     ----ETENDKLLLAARRIRRATCTDFIISLSAKNFSRSSS--TYVGKL------------
gm021742_Glyma0 ---LLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSN--TYIGKL------------
Sm012016_Selmo1 DAGL-QEHGKFLLAARKVRRATTTDYIISLDPEDFSRGST--SYVGKL------------
gm021743_Glyma0 ---LLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSN--TYIGKL------------
Os021774_Os05t0 ---VLADSGKFLLSAKRHRKTTCTEYVISMDADNISRSSS--TYIGKL------------
pt000712_POPTR_ ---LLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSS--TYIGKL------------
gm041219_Glyma1 ---LLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSN--TYIGKL------------
Os021773_Os05t0 ---VLADSGKFLLSAKRHRKTTCTEYVISMDADNISRSSS--TYIGKL------------
Os029490_Os07t0 ---L-TDDGKFLLAARKCRRTTCTEYLISLDMNDISKRTD--SYVGKL------------
pp034759_Pp1s15 ---L-VENGKFLLAAKKFRRPTRTDYIISLNHDDMSRGGT--AYVGKL------------
gm045744_Glyma1 ---LVADDGKFLLAARKFRRPTCTDYIISLDADDMSRESN--AYVGKLRSTLNQILLLAI
Os029803_Os08t0 ---VLSENGKFLLAAKRNRRATSTEYIISVDSKNISRSSN--GYVGKM------------
gm003397_Glyma0 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNS--TYIGKL------------
Os009468_Os02t0 ---LHGENDKLLLAARKIRRATRTSFVISLVSNDFSLSSS--TYVGKL------------
pp000633_Pp1s10 ---L-IENGKFLLAARKFRRATSTDYIISLNQEDMSRGSN--TYVGKL------------
pt001717_POPTR_ ---LSGDMSKLLLAAKKIRKATSTDFRISFVGSDFCQTSN--TYAGKL------------
Sb028483_Sorbi1 ---VPAEDGKFLLSAKRNCRPTYTEYTISINSGDISRSTSNNTYIGKL------------
gm044960_Glyma1 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNS--TYIGKL------------
pt041132_POPTR_ ---L-TEDGKFLLAARKCRRPTCTDYIISLDTDDMSKGSN--AYVGKL------------
gm054929_Glyma2 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSS--TYIGKL------------
Os004869_Os01t0 ---VTAEGGKFVLAAKRHRKTTCTEYTISMVSGNISRSSR--TNIGKL------------
gm030081_Glyma1 ----ENETDKLLLAAKKVRRATGTDFIISLVADDFSRSSN--TYVGKL------------
gm048089_Glyma1 ---LSGDMSKLLLAAKKIRRATCTEFIISLVSDDFSWASN--TYVGKL------------
Os019649_Os04t0 ---VLDETGKFLLSAKRSRRTTHTDYIISMDSKNISRSSS--GYIGKL------------
Sb027814_Sorbi1 ---MNMENDKLLLAARKVRRATRTSFVISLVSDDFSHSSS--TYVGKL------------
pp034735_Pp1s15 ---L-VENGKFLLAARKFRRAASTDYIISLNQEDISRGSN--TYVGKL------------
gm039265_Glyma1 ---LSGDMSKLLLAAKKIRRATCTEFIISLVADDFSRACD--TYVGKL------------
pt034249_POPTR_ ---L-TEDGKFLLAARKCRRPTCTDYIISLDTDDMSKGSN--TYAGKL------------
Sb024300_Sorbi1 ---L-ADDGKFLLAARRSRRPAGTEYLISLDAKNTSKG----TCIGKL------------
gm054928_Glyma2 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSSS--TYIGKL------------
Sb032660_Sorbi1 ---VLMENGKFLLSAKRNRKTTCTEYVISMDAENISRSSS--TYIGKL------------
gm021740_Glyma0 ---LLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSN--TYIGKL------------
gm041730_Glyma1 ---L-AEDGKFLLAARKCRRPTCTDYIISLDADDMSKGSN--SYVGKL------------
gm045746_Glyma1 ---LVADDGKFLLAARKFRRPTCTDYIISLDADDMSRESN--AYVGKL------------
gm003396_Glyma0 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNS--TYIGKL------------
gm044959_Glyma1 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNS--TYIGKL------------
gm004126_Glyma0 ---S-TDEGKFLLSARKCRRATHTDYIISLNCDDVSRGSS--TYIGKL------------
pt000710_POPTR_ ---LLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSS--TYIGKL------------
pp034734_Pp1s15 ---L-VENGKFLLAARKFRRAASTDYIISLNQEDISRGSN--TYVGKL------------
pp022942_Pp1s22 ---L-VENGKFLLAARKCRRATSTDYIVSLNHEDMSRGSN--TYVGKL------------
gm021741_Glyma0 ---LLVENGKFLLSAKRTRRTTYTEYVISMDADNISRSSN--TYIGKL------------
gm036751_Glyma1 ---L-AEDGKFLLAARKCRRPTCTDYIISLDADDMSKGSN--SYVGKL------------
Sm016835_Selmo1 -KPS-KKNGKFLLAARKFRRASGTDYIISTDTDDFSRGSN--TYVGKL------------
gm028526_Glyma1 ---LLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSS--TYIGKL------------
pp022947_Pp1s22 ---L-VENGKFLLAARKFRRATSTDYIISLNQENMSRGSN--TYVGKL------------
pt000711_POPTR_ ---LLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSS--TYIGKL------------
pt037558_POPTR_ ----EGENDKLLLAARKIRRATCSDFIVSLVSDDFSRASN--TYVGKL------------
gm037352_Glyma1 -----TDKGKFLLAARRYRCGTHTEYIISLDADDLSQGSN--AYVGKL------------
gm019438_Glyma0 ---LIADDGKFLLAARKFRRPTCIDYIISLDADDMSRESN--AYVGKL------------
pt039357_POPTR_ ---LLVENGKFLLSAKRKRRTACTEYVISMDADNVSRSSS--TYIGKL------------
pt037730_POPTR_ ---LSGDMNKVLLAAKKIRKATSTDFRISFAGSDFCQTSN--TYVGKL------------
gm030080_Glyma1 ----ENETDKLLLAAKKVRRATGTDFIISLVADDFSRSSN--TYVGKL------------
Os019651_Os04t0 ---VLDETGKFLLSAKRSRRTTHTDYIISMDSKNISRSSS--GYIGKL------------
pt028965_POPTR_ -----TDKGKFLLAARRYRQGVHTEYIISLDADDLSQGSN--AYVGKL------------
pt000709_POPTR_ ---LLVENGKFLLSAKRSRRTTCTEYVISMDADNISKSSS--TYIGKL------------
pt037559_POPTR_ ----EGENDKLLLAARKIRRATCSDFIVSLVSDDFSRASN--TYVGKL------------
gm003395_Glyma0 ---LLVENGKFLLSAKRTRRTTCTEYIISMDADNISRSNS--TYIGKL------------
gm045745_Glyma1 ---LVADDGKFLLAARKFRRPTCTDYIISLDADDMSRESN--AYVGKL------------
gm028527_Glyma1 ---LLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSS--TYIGKL------------
Os009471_Os02t0 ---LHGENDKLLLAARKIRRATRTSFVISLVSNDFSLSSS--TYVGKL------------
pt002868_POPTR_ ---LLVENGKFLLSAKRTRRTTCTEYVISMDADNISRSSS--TYIGKL------------
gm039266_Glyma1 ---LSGDMSKLLLAAKKIRRATCTEFIISLVADDFSRACD--TYVGKL------------
pp005711_Pp1s21 ---Q--ENGKFLLAAQKFRRATSTDYIISLNQEDMSRGSS--TYVGKL------------
gm003133_Glyma0 ----ENDSNKLLLAAKRIRRATGTGFVISLAADDFSRASN--KYVGKL------------
gm034540_Glyma1 -----TDKGKFLLAARRYRCGTHTEYIISLDADDLSQGSN--AYVGKL------------
gm044675_Glyma1 ----ENDGNKLLLAAKRIRRATGTDFIISLAADDFSRASN--KYVGKL------------
Sm008088_Selmo1 ---L-TENGKFLLAARKSRRATSTDYIISIDPEDMSRGSS--SCVGKL------------
gm001764_Glyma0 ----ENETDKLLLAAKKVRRATGTDFVISLVADDFFRSSN--TYVGKL------------
pt001281_POPTR_ ----GGENDKLLLAARKIRRATCTDFIVSLVSDDFSRASN--TYVGKL------------
Os029491_Os07t0 ---L-TDDGKFLLAARKCRRTTCTEYLISLDMNDISKRTD--SYVGKL------------
Os040209_Os12t0 ---VLVESGKFLLSAKRYSRATCTEYTIFMSADNTSRSSN--MYIGKL------------
                      . .*.:*:*::        : :     :           **:            

AT2G18280.1     ------------------RSGFLGTKFTIYDNQTASSTA-----Q-AQPNRR-LHPKQ-A
gm021742_Glyma0 ------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-FYSKK-V
Sm012016_Selmo1 ------------------RSNFLGTKFTIYDSQPPHVGAMPSN---SRVGRR-FGSKQ-I
gm021743_Glyma0 ------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-FYSKK-V
Os021774_Os05t0 ------------------RSNFLGTKFIIYDTQPSYNGAVIPPVG--RSSRR-FNSKK-V
pt000712_POPTR_ ------------------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSRR-FYSKK-V
gm041219_Glyma1 ------------------RSNFLGTKFIIYDTQPPYSSAHICPPGTGKTSRR-FYSKK-V
Os021773_Os05t0 ------------------RSNFLGTKFIIYDTQPSYNGAVIPPVG--RSSRR-FNSKK-V
Os029490_Os07t0 ------------------RSNFLGTKFTIYDAHPPYAGDVISK---GQSARV-IGSNH-L
pp034759_Pp1s15 ------------------RSNFLGTKFTIYDSQPSHNGVAAS----NRGAWR-MGTKQ-L
gm045744_Glyma1 LLFLFLSAKTNPLSSHFIRSNFLGTKFTIYD----------RK---SCSTELVVNSKQ-V
Os029803_Os08t0 ------------------RSNFLGTKFVVYDTQPPYNAGSLMSCQ--HGSRR-ISSRR-V
gm003397_Glyma0 ------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-FYSKK-V
Os009468_Os02t0 ------------------KPNFLGTKFTIFDSQPPCDAVVLP--N-NRPSKR--HFKQ-V
pp000633_Pp1s10 ------------------RSNFLGTKFTIYDSQPPHNRGVAS----NRSSRR-IGSKQ-L
pt001717_POPTR_ ------------------RSNFLGTKFTIYDSQPPCPGLKS---N-CKLQQK-VRSIQ-V
Sb028483_Sorbi1 ------------------RSNFLGTKFVIYDTQPPYNATSPTVAG--KTNQR-FYSKKGG
gm044960_Glyma1 ------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-FYSKK-V
pt041132_POPTR_ ------------------RSNFLGTKFTVFDGQPPHAGAKMTK---SRSSRL-VNLKQ-V
gm054929_Glyma2 ------------------RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSRR-F-SKK-V
Os004869_Os01t0 ------------------RSNFLGTKFIIYDTQPPYNGAVVPHVG--RTSKR-FNSTK-V
gm030081_Glyma1 ------------------RSNFLGTKFTIYDSQPPHGAAIQP--D-SQPSRR-FHSKQ-V
gm048089_Glyma1 ------------------RSNFLGTKFTILDGEPAHETSLPL--N-CKLQQR-VHLKQ-V
Os019649_Os04t0 ------------------RSNFLGTKFIIYDTQPPYNARTLCSQE--RTSRR-FSSRK-V
Sb027814_Sorbi1 ------------------KPNFLGTKFTIFDSQPPPDAVVLP--N-NKPSKR--QSKQ-V
pp034735_Pp1s15 ------------------RSNFLGTKFTIYDSQPSHNGVAAS----NRGAWR-MGTKQ-L
gm039265_Glyma1 ------------------RSNFLGTKFTILDGEPPHDSSLPL--N-CKLQQR-VHLKQ-V
pt034249_POPTR_ ------------------RSNFLGTKFTVFDGQPPHAGAKMTK---SYSSRL-VNLKQ-V
Sb024300_Sorbi1 ------------------RSNFLGTKFTVYDAHPPCTGAVVSK---GPSAHM-IGSAQ-V
gm054928_Glyma2 ------------------RSNFLGTKFIIYDTQPPYHNAMLSPPG---RSRR-F-SKK-V
Sb032660_Sorbi1 ------------------RSNFLGTKFMISDTQPPYNGAVVPHAG--RTSRR-FNSKK-V
gm021740_Glyma0 ------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-FYSKK-V
gm041730_Glyma1 ------------------RSNFLGTKFTIYDGQPPHAGAKIMK---SRSTRL-VNLKQ-V
gm045746_Glyma1 ------------------RSNFLGTKFTIYD----------RK---SCSTELVVNSKQ-V
gm003396_Glyma0 ------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-FYSKK-V
gm044959_Glyma1 ------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-FYSKK-V
gm004126_Glyma0 ------------------RSNFLGTKFTVYDAHPPIYGAKVTK---SRSTRL-VSLKQ-V
pt000710_POPTR_ ------------------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSRR-FYSKK-V
pp034734_Pp1s15 ------------------RSNFLGTKFTIYDSQPSHNGVAAS----NRGAWR-MGTKQ-L
pp022942_Pp1s22 ------------------RSNFLGTKFTIYDSQPPHSGVVAS----NRGTRR-LGSKQ-L
gm021741_Glyma0 ------------------RSNFLGTRFIICDTQPPYSSAHICPPMTGKTSRR-FYSKK-V
gm036751_Glyma1 ------------------RSNFLGTKFTIYDSQLPHTGAKIMK---SRSTRL-VNLKQ-V
Sm016835_Selmo1 ------------------RSNFMGTKFTLYDSNPPHDGAVAST---NRAGRR-ILSKQ-V
gm028526_Glyma1 ------------------RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSRR-F-SKK-V
pp022947_Pp1s22 ------------------RSNFLGTKFTIYDSQPPHSGVVAS----NRGTRR-MGSKQ-L
pt000711_POPTR_ ------------------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSRR-FYSKK-V
pt037558_POPTR_ ------------------RSNFLGTKFTMYDCEPTFEVPTQTQHA-NRISRR-FHSRQ-V
gm037352_Glyma1 ------------------SSDFLGTNFTIYDSQPPHSGAKPSS---GRASRR-FASKQ-I
gm019438_Glyma0 ------------------RSNFLGTKFTIYDIPLPHVGAKMTK---SCFTKL-VNPKQ-V
pt039357_POPTR_ ------------------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSRR-FYSKK-V
pt037730_POPTR_ ------------------RSNFLGTKFTIYDGQTPCPAMRS---N-CKPQRK-VRSIQ-V
gm030080_Glyma1 ------------------RSNFLGTKFTIYDSQPPHGAAIQP--D-SQPSRR-FHSKQ-V
Os019651_Os04t0 ------------------RSNFLGTKFIIYDTQPPYNARTLCSQE--RTSRR-FSSRK-V
pt028965_POPTR_ ------------------SSDFLGTNFTIYDSQPPHSGAKPSS---SRASRR-FASKQ-I
pt000709_POPTR_ ------------------RSNFLGTKFIIYDTQPPYNNAQLAPPG---RSRR-FYSKK-V
pt037559_POPTR_ ------------------RSNFLGTKFTMYDCEPTFEVPTQTQHA-NRISRR-FHSRQ-V
gm003395_Glyma0 ------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-FYSKK-V
gm045745_Glyma1 ------------------RSNFLGTKFTIYD----------RK---SCSTELVVNSKQ-V
gm028527_Glyma1 ------------------RSNFLGTKFIIYDTQPPYNNAMLSPPG---RSRR-F-SKK-V
Os009471_Os02t0 ------------------KPNFLGTKFTIFDSQPPCDAVVLP--N-NRPSKR--HFKQ-V
pt002868_POPTR_ ------------------RSNFLGTKFIIYDTQPPYNNAQLSPPG---RSRR-FYSKK-V
gm039266_Glyma1 ------------------RSNFLGTKFTILDGEPPHDSSLPL--N-CKLQQR-VHLKQ-V
pp005711_Pp1s21 ------------------RSNFLGTKFTIYDSQPPQNGPVLS----NRSSRR-LTSKQ-L
gm003133_Glyma0 ------------------RSNFLGTKFTVYDSQAPHDSAIQS--N-CQSSRR-FHSKQ-V
gm034540_Glyma1 ------------------SSDFLGTNFTIYDSQPPHSGAKPSS---GRASRR-FASKQ-I
gm044675_Glyma1 ------------------RSNFLGTKFTIFDSQAPNDVAIQP--N-CQSSRR-FHSKQ-V
Sm008088_Selmo1 ------------------RSNFLGTKFAIYDTQPPHSGAIAST---NRAGRR-VAAKQ-V
gm001764_Glyma0 ------------------RSNFLGTKFTIYDSQPPQGAAIQP--D-NRSSRR-FHSKQ-V
pt001281_POPTR_ ------------------RSNFLGTKFTMYDSEPTFEVPRQL--A-SRTSRR-FNPRQ-V
Os029491_Os07t0 ------------------RSNFLGTKFTIYDAHPPYAGDVISK---GQSARV-IGSNH-L
Os040209_Os12t0 ------------------RSNLLGTKFVIYDTQPPCNTANVSQSG--KTSRR-FYSRK-V
                                   ..::**.* : *                          :  

AT2G18280.1     A--P-KL-PTNSSTVGNITYELNVLRTRGP------RRMHCAMDSIPLSSV---------
gm021742_Glyma0 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDA---GGT-
Sm012016_Selmo1 S--P-RV-PSGSYNVAHIAYELNVLGTRGP------RRMQVTIHSIPASAMDP---GGV-
gm021743_Glyma0 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDA---GGT-
Os021774_Os05t0 S--P-KM-PSGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASSVEP---GGI-
pt000712_POPTR_ S--P-KV-PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEP---GGS-
gm041219_Glyma1 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDA---GGT-
Os021773_Os05t0 S--P-KM-PSGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASSVEP---GGI-
Os029490_Os07t0 S--P-RI-PAGNYPVSHISYELNVLGSRGP------RRMHCAMDSIPVSAIEQ---GGT-
pp034759_Pp1s15 S--S-RV-HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACAMES---GGS-
gm045744_Glyma1 SPRP-RV-PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEP---GGVA
Os029803_Os08t0 S--P-KL-PTGSYPIAHVKYELNVLGTRGP------RRMQCTMHSIPASAVDP---EGV-
gm003397_Glyma0 S--P-KV-PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEP---GCT-
Os009468_Os02t0 S--P-RL-PLGNYNVATVSYELTVLRNRGP------RRMQCTMHSIPALCIQE---GGK-
pp000633_Pp1s10 T--S-RV-HAGSYNVAHIAYELNVLGTRGP------RRMQCMLHTIPMSAMES---GGS-
pt001717_POPTR_ S--P-GV-PARNFNVATVSYELNVLRTRGP------RRMHCIVHSIPISAIQE---GGV-
Sb028483_Sorbi1 S--T-KG-SCSRYSIGQVSYELNVLGTRGP------RRMNCVMHSIPASCLEA---GGS-
gm044960_Glyma1 S--P-KV-PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEP---GCT-
pt041132_POPTR_ S--P-RV-PTGNYPVASISYELNVLGSRGP------RRMHCIMDAIPASAIEP---GGI-
gm054929_Glyma2 S--P-KV-PSGSYNIAHVTYELNVLGTRGP------RRMNCTMYSIPASSMEP---NGI-
Os004869_Os01t0 S--P-KV-PSVTYNIAQVSYELNVLGTRGP------RRMRCMMHSIPASSVEP---GGI-
gm030081_Glyma1 S--P-RV-PACNYVVSTIAYELNVLRARGP------RRMHCTMNSIPVSAVQA---GGN-
gm048089_Glyma1 L--PNKVAAAANYKVATRSKANAVYDALNPHICNPRRRER--------------------
Os019649_Os04t0 S--P-KV-PTGCYPIVQVNYELNVLGTRGP------RRMQCAMHSIPASAVEP---GGI-
Sb027814_Sorbi1 S--P-RL-PLGNYNVATVTYELTVLRNRGP------RRMQCTMHSIPAECIQE---GGK-
pp034735_Pp1s15 S--S-RV-HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACAMES---GGS-
gm039265_Glyma1 L--PNKV-SAANYKVATVSYELNVLRTRGP------RRMRCMMHLIPISAIQE---GGN-
pt034249_POPTR_ S--P-RV-PTGNYPVANISYELNVLGSRGP------RRMHCIMDAIPAAAIEP---GGV-
Sb024300_Sorbi1 S--P-GV-PAGNYPISHISYEAT-FGSRYP------RKMNCVMDSIPLSAIKE---GGT-
gm054928_Glyma2 S--P-KV-PSGSYNIAHVTYELNVLGTRGP------RRMNCTMYSIPASSMEP---NGI-
Sb032660_Sorbi1 S--P-KV-PTGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASAVEP---GGI-
gm021740_Glyma0 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDA---GGT-
gm041730_Glyma1 S--P-KV-PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPAAAIEP---GGV-
gm045746_Glyma1 SPRP-RV-PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEP---GGVA
gm003396_Glyma0 S--P-KV-PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEP---GCT-
gm044959_Glyma1 S--P-KV-PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEP---GCT-
gm004126_Glyma0 S--P-RV-PAGNYPIAHVSYDLNVLGSRGP------RIMQCVMDAIPASAVEP---GGV-
pt000710_POPTR_ S--P-KV-PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEP---GGS-
pp034734_Pp1s15 S--S-RV-HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACAMES---GGS-
pp022942_Pp1s22 T--S-RV-HCGSHNVAHIAYELNVLGTRGP------RRMQCTMHSIPASAMAS---GGS-
gm021741_Glyma0 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDA---GGT-
gm036751_Glyma1 S--P-KV-PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPATAIEP---GGV-
Sm016835_Selmo1 S--P-RV-PAGSYNIAHIAYELNVLGTRGP------RRMECTIHSIPASAMEP---GGC-
gm028526_Glyma1 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RRMNCTMYSIPASSMEP---NGV-
pp022947_Pp1s22 T--S-RV-HCGSYNVAHIAYELNVLGTRGP------RRMQCTMHSIPASAMAS---GGS-
pt000711_POPTR_ S--P-KV-PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEP---GGS-
pt037558_POPTR_ S--P-RL-PACNYSIGTITYELNVLRSRGP------RRMHCMMHSIPMSSIEE---GGT-
gm037352_Glyma1 S--P-QV-PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVTPV---------
gm019438_Glyma0 S--P-RV-PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEP---GGVA
pt039357_POPTR_ S--P-KV-PTGSYNIAQVTYELNVLGTRGP------RRMHCTMHSIPALSLEP---GGS-
pt037730_POPTR_ S--P-GV-AARNYNVATVSYELNVLRTRGP------RRMHCTIHSIPISAIQE---GGI-
gm030080_Glyma1 S--P-RV-PACNYVVSTIAYELNVLRARGP------RRMHCTMNSIPVSAVQA---GGN-
Os019651_Os04t0 S--P-KV-PTGCYPIVQVNYELNVLGTRGP------RRMQCAMHSIPASAVEP---GGI-
pt028965_POPTR_ S--P-QV-PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVSQ----------
pt000709_POPTR_ S--P-KV-PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEP---GGS-
pt037559_POPTR_ S--P-RL-PACNYSIGTITYELNVLRSRGP------RRMHCMMHSIPMSSIEE---GGT-
gm003395_Glyma0 S--P-KV-PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEP---GCT-
gm045745_Glyma1 SPRP-RV-PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEP---GGVA
gm028527_Glyma1 S--P-KV-PSGSYNIAQVTYELNVLGTRGP------RRMNCTMYSIPASSMEP---NGV-
Os009471_Os02t0 S--P-RL-PLGNYNVATVSYELTVLRNRGP------RRMQCTMHSIPALCIQE---GGK-
pt002868_POPTR_ S--P-KV-PTGSYNIAQVTYELNVLGTRGP------RRMHCTMHSIPASSLEP---GGS-
gm039266_Glyma1 L--PNKV-SAANYKVATVSYELNVLRTRGP------RRMRCMMHLIPISAIQE---GGN-
pp005711_Pp1s21 S--Y-RA-HAGSFNVAHIAYELNVLGTRGP------RRMQCTLHGIPLSTMES---VGS-
gm003133_Glyma0 S--P-RV-PACSYLVSTVSYELNVLCTRGP------RRMHCVMNSIPVSAIQE---GGN-
gm034540_Glyma1 S--P-QV-PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLKC-PVTP----------
gm044675_Glyma1 S--P-RL-PACNYLVSTVSYELNVLCTRGP------RRMYCVMNSIPVSAIQE---GGN-
Sm008088_Selmo1 S--P-KV-PAGSYNVAHISYELNVLGTRGP------RRMQCTLHAVGAVSMDSDSEGMA-
gm001764_Glyma0 S--P-RV-PACNYVVSTIAYELNVLRARGP------RRMHCTMNSISVSAVQE---GGN-
pt001281_POPTR_ S--L-RL-PACNYCIATITYELNVLRSRGP------RRMHCIMHSIPMSSIEE---GGT-
Os029491_Os07t0 S--P-RI-PAGNYPVSHISYELNVLGSRGP------RRMHCAMDSIPVSAIEQ---GGT-
Os040209_Os12t0 S--P-KN-PSSTYSIAQVSYELNVLGTRGP------RRMNCVMHSIPASSLEA---GGT-
                              :              *      *                       

AT2G18280.1     ---IAEPS--VVQGI-EEEVSS---------------SPSPKGETI----TTDKEIPDNS
gm021742_Glyma0 --VPGQPE-LLPRPL-EDSFRS--ISFSKS-----------LDRSI------EF----SS
Sm012016_Selmo1 --APTPTV--F-ANP-LED-AQ--LPF-------------PVSKSK------VS----DC
gm021743_Glyma0 --VPGQPE-LLPRPL-EDSFRS--ISFSKS-----------LDRSI------EF----SS
Os021774_Os05t0 --VPGQPEQIVPRAF-EESFRST-TSFSKS---------SIMDRSMDFSSSRDF----SS
pt000712_POPTR_ --VPGQPE-LLPCSL-EDSFRS--ISFSKS-----------IDNST------EF----SS
gm041219_Glyma1 --VPGQPE-LLPRSL-EDSFRS--ISFSKS-----------LDHSI------EF----SS
Os021773_Os05t0 --VPGQPEQIVPRAF-EESFRST-TSFSKS---------SIMDRSMDFSSSRDF----SS
Os029490_Os07t0 --APTQTE--FPLSY-HESFTS--IPF-------------FKSKSV--------------
pp034759_Pp1s15 --APTPTE--LAAGS-LEE-VH--VPYSSI-------MSSPRSKAA------VV----DS
gm045744_Glyma1 VAAPSQTD--FSVSN-RD--TS--FPF-------------FQTNST--------------
Os029803_Os08t0 --VPGQPEQLLPGPF-EESFRSTNTS-SRF---------SFMDRSL------DF----SS
gm003397_Glyma0 --VPGQPE-LLPRSL-EDSFRS--ISFARS-----------IDNST------EF----SS
Os009468_Os02t0 --APTPTG--IIHSL-DEQVPA---------------LSTSKGKEP----AIEF----SS
pp000633_Pp1s10 --APTPTE--FTAST-LED-TH--VAYSGI-------LSSPRSRAA------VV----DS
pt001717_POPTR_ --APTPLE--FNNPG-DEQSPS---------------LSASKVKQP----LIDF----IS
Sb028483_Sorbi1 --VPCQPDSIVAHSV-GEMFSS--IPLSKS---------STMDHSM------HF----SS
gm044960_Glyma1 --VPGQPE-LLPRSL-EDSFRS--ISFARS-----------IDNST------EF----SS
pt041132_POPTR_ --APTQTE--FSHHN-VDFLPS--LPF-------------FRSKSN--------------
gm054929_Glyma2 --VPGQPE-LLPRAL-EDSFRS--ISFSKS-----------IDNST------EF----SS
Os004869_Os01t0 --VPGQPEQIVPRAL-EDSFRST-TSFSQSFRSTTSFSKSIMDPSM------DF----SS
gm030081_Glyma1 --APTPT---FPEII-DEPFSP---------------SPALKGKGP----IRDL----DN
gm048089_Glyma1 -----PYS--F-----EHASTT---------------TPDSKGKKP---EVVEF----DS
Os019649_Os04t0 --VPGQPKELLPRLF-EESFRSMATSFSKY---------SITDHST------DF----SS
Sb027814_Sorbi1 --APTPTG--TIQSL-DEPVST---------------SPSTKGKEV----ALEF----SS
pp034735_Pp1s15 --APTPTE--LAAGS-LEE-VH--VPYSSI-------MSSPRSKAA------VV----DS
gm039265_Glyma1 --APTPLK--FTNYLNDYASTT---------------IPDTKGKKP---EVVEF----DS
pt034249_POPTR_ --APTQTE--FYHHS-ADFFPS--LLF-------------FRSKSN------RV------
Sb024300_Sorbi1 --APTQTE--FPSIN-SNSFAS--VPF-------------FRKSG---------------
gm054928_Glyma2 --VPGQPE-LLPRAL-EDSFRS--ISFSKS-----------IDNST------EF----SS
Sb032660_Sorbi1 --VPGQPEQILPRAL-EESFRST-TSFSKS---------SIMDRSMDFSSSRDF----SS
gm021740_Glyma0 --VPGQPE-LLPRPL-EDSFRS--ISFSKS-----------LDRSI------EF----SS
gm041730_Glyma1 --APVQTE--FSLNN-IDMFPS--FPF-------------FRSKSN--------------
gm045746_Glyma1 VAAPSQTD--FSVSN-RD--TS--FPF-------------FQTNST--------------
gm003396_Glyma0 --VPGQPE-LLPRSL-EDSFRS--ISFARS-----------IDNST------EF----SS
gm044959_Glyma1 --VPGQPE-LLPRSL-EDSFRS--ISFARS-----------IDNST------EF----SS
gm004126_Glyma0 --APTQTQ--FLHSR-IDTSPS--IPF-------------FRSKST--------------
pt000710_POPTR_ --VPGQPE-LLPCSL-EDSFRS--ISFSKS-----------IDNST------EF----SS
pp034734_Pp1s15 --APTPTE--LAAGS-LEE-VH--VPYSSI-------MSSPRSKAA------VV----DS
pp022942_Pp1s22 --APTPTE--FTSCG-LEE-AH--VPYSSI-------LLSPRSKAA------VV----DS
gm021741_Glyma0 --VPGQPE-LLPRPL-EDSFRS--ISFSKS-----------LDRSI------EF----SS
gm036751_Glyma1 --APTQTE--FSLNN-IDMFPS--FPF-------------FRSKSN--------------
Sm016835_Selmo1 --APTPLE--S-ATS-MDE-AS--MLPPLL-------LPVGAKSSK------VA----AL
gm028526_Glyma1 --VPGQPE-LLPRAL-EDSFRS--ISFSKS-----------IDNST------EF----SS
pp022947_Pp1s22 --APTPTE--FTSCG-LEE-AH--VPYSSI-------LLSPRSKAA------VV----DS
pt000711_POPTR_ --VPGQPE-LLPCSL-EDSFRS--ISFSKS-----------IDNST------EF----SS
pt037558_POPTR_ --VPTLTS--LTETF-GGQFPH---------------LSTSKGKES----VSDI----SS
gm037352_Glyma1 V-SPSVES--------SDSTPV------------------------------------NG
gm019438_Glyma0 V-APSQTD--FSVSN-ID--TS--FPF-------------FQTNST--------------
pt039357_POPTR_ --VPGQPE-LLPRCL-EDSFRS--ISFSKS-----------IDNST------EF----SS
pt037730_POPTR_ --APTPSE--FNNPS-NEQSSP---------------LSASKLKQP----PIDF----SS
gm030080_Glyma1 --APTPT---FPEII-DEPFSP---------------SPALKGKGP----IRDL----DN
Os019651_Os04t0 --VPGQPKELLPRLF-EESFRSMATSFSKY---------SITDHST------DF----SS
pt028965_POPTR_ ------ET--------TNVKNV------------------------------------DN
pt000709_POPTR_ --VPGQPE-LLPCSL-EDSFRS--ISFSKS-----------IDNST------EF----SS
pt037559_POPTR_ --VPTLTS--LTETF-GGQFPH---------------LSTSKGKES----VSDI----SS
gm003395_Glyma0 --VPGQPE-LLPRSL-EDSFRS--ISFARS-----------IDNST------EF----SS
gm045745_Glyma1 VAAPSQTD--FSVSN-RD--TS--FPF-------------FQTNST--------------
gm028527_Glyma1 --VPGQPE-LLPRAL-EDSFRS--ISFSKS-----------IDNST------EF----SS
Os009471_Os02t0 --APTPTG--IIHSL-DEQVPA---------------LSTSKGKEP----AIEF----SS
pt002868_POPTR_ --VPGQAE-LLPRSL-EDSFRS--ISFSKS-----------IDNST------EF----SS
gm039266_Glyma1 --APTPLK--FTNYLNDYASTT---------------IPDTKGKKP---EVVEF----DS
pp005711_Pp1s21 --APSPTE--VTADS-LER-AH--VPHSGV-------MSSSRSKAA------VV----DI
gm003133_Glyma0 --APTPTS--FPQIF-DEPFSP---------------SPALKEKAQ----VTDL----NS
gm034540_Glyma1 V-SPTSGS--------SDSTPV------------------------------------NG
gm044675_Glyma1 --APTPAS--YPQIF-DEHFSP---------------SPALKEKVP----VTDL----NS
Sm008088_Selmo1 --VPASTE--LAAAP-VAD-DA--VGEPGL-------SSSGGDRYV--------------
gm001764_Glyma0 --APTPTS--FPQII-DEPFSP---------------SPALKGKGP----IRDL----DN
pt001281_POPTR_ --VQTLTS--IPEAF-NGQFPH---------------LSSSIGKEL----VSDN----SS
Os029491_Os07t0 --APTQTE--FPLSY-HESFTS--IPF-------------FKSKSV--------------
Os040209_Os12t0 --VPCQPDSVLARSL-DESFGS--ISFSKS---------SIMDRSI------RF----SS
                                                                            

AT2G18280.1     PSLRD------------------------QPLVLKNKSPRWHEQLQCWCLNFKGRVTVAS
gm021742_Glyma0 SRFSEIGES-----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVAS
Sm012016_Selmo1 STAPVVVPYSGVM-------------SKDGPLVLKNKAPRWHDQLQCWCLNFRGRVTVAS
gm021743_Glyma0 SRFSEIGES-----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVAS
Os021774_Os05t0 ARFSDIAGG-TI-------NGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIAS
pt000712_POPTR_ SRFSNIVGP-----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVAS
gm041219_Glyma1 SRFSEIGES-----------CIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVAS
Os021773_Os05t0 ARFSDIAGG-TI-------NGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIAS
Os029490_Os07t0 -RANNS-TASLLT-------------QNGSKLVLKNKSPRWHEHLQCWCLNFHGRVTVAS
pp034759_Pp1s15 SALESSEFVSGLL-------------NKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
gm045744_Glyma1 -SLENSISGDQSN-------------KKDDVLVLRNKAARWHEQLQCWCLNFHGRVTIAS
Os029803_Os08t0 SRFSEISGSANQ------QGEDDIPEAKERPLVLRNKVPRWHEQLQCWCLNFRGRVTVAS
gm003397_Glyma0 SRFSDIFVA-----------GNEEEQGKGRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
Os009468_Os02t0 TSLSADLSG--------------PVCTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
pp000633_Pp1s10 STLD-CDFVSGPL-------------TKDAPLILKNKAPRWHEQLQCWCLNFRGRVTVAS
pt001717_POPTR_ TSRAE-SSD--------------SICSKMDPLVLKNKAPRWHEQLQCWCLNFKGRVTVAS
Sb028483_Sorbi1 SRFSDAITADAIVSGGQALSNADDEESTDTPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
gm044960_Glyma1 SRFSDIFLA-----------GKEEEQGKDRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
pt041132_POPTR_ -RVESFQSGSLSS-------------QREGALVLKNKAPRWHEQLQCWCLNFHGRVTVAS
gm054929_Glyma2 SRFSDIMGI-----------GNEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
Os004869_Os01t0 ARFSDISGS-IM-------GGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIAS
gm030081_Glyma1 ASLPELLPV--------------ESQGSAEPLVLKNKAPRWHEQLQCWCLNFKGRVTVAS
gm048089_Glyma1 TGTAN-TPE--------------SIQRAREPLVLKNKAPRWHEQLQCWCLNFKGRVTVAS
Os019649_Os04t0 SRFSEFGGGALQGQE-QEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
Sb027814_Sorbi1 TSLSADLSGL------------ALACANETPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
pp034735_Pp1s15 SALESSEFVSGLL-------------NKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
gm039265_Glyma1 TGTDN-TPE--------------SIQRAREPLILKNKAPRWHEQLQCWCLNFKGRVTVAS
pt034249_POPTR_ ERVESFQSGPLSS-------------QREGALVLRNKAPRWHEQLQCWCLNFHGRVTVAS
Sb024300_Sorbi1 -RLDSS-GVQLAT-------------QNEAKMVLKNKSPNWHEPLQCWCLNFHGRVTVAS
gm054928_Glyma2 SRFSDIMGI-----------GNEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
Sb032660_Sorbi1 ARFSDIAGGAAI-------AGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIAS
gm021740_Glyma0 SRFSEIGES-----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVAS
gm041730_Glyma1 -RVENSVSGPLVD-------------QKDGMLVLKNKAPRWHEQLQCWCLNFHGRVTIAS
gm045746_Glyma1 -SLENSISGDQSN-------------KKDDVLVLRNKAARWHEQLQCWCLNFHGRVTIAS
gm003396_Glyma0 SRFSDIFVA-----------GNEEEQGKGRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
gm044959_Glyma1 SRFSDIFLA-----------GKEEEQGKDRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
gm004126_Glyma0 -RMDNLPTVPLTC-------------QNEGTLVLRNKSPRWHEHLQCWCLNFNGRVTVAS
pt000710_POPTR_ SRFSNIVGP-----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVAS
pp034734_Pp1s15 SALESSEFVSGLL-------------NKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
pp022942_Pp1s22 SALESSELVSGVL-------------CKEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
gm021741_Glyma0 SRFSEIGES-----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVAS
gm036751_Glyma1 -RAENSMSGPLVD-------------QKDGMLVLKNKAPRWHEQLQCWCLNFHGRVTIAS
Sm016835_Selmo1 DGLEGLEVAS-----------------KGKPLVLKNKPPRWHDQLQCWCLNFRGRVTVAS
gm028526_Glyma1 SRFSDIMGT-----------GIEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
pp022947_Pp1s22 SALESSELVSGVL-------------CKEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
pt000711_POPTR_ SRFSNIVGP-----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVAS
pt037558_POPTR_ PSPSQ-SPV--------------LTQGSEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
gm037352_Glyma1 HKIPD------------------KEQVASGYTILKNKAPRWHEHLQCWCLNFHGRVTVAS
gm019438_Glyma0 -SLENSISGDQRN-------------KKDDVLVLRNKAARWHEQLECWCLNFHGRVTIAS
pt039357_POPTR_ SRFSDIVGP-----------REEDEEGKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
pt037730_POPTR_ NSLAE-SSD--------------SLCSKNDPLILKNKAPRWHEQLQCWCLNFKGRVTVAS
gm030080_Glyma1 ASLPELLPV--------------ESQGSAEPLVLKNKAPRWHEQLQCWCLNFKGRVTVAS
Os019651_Os04t0 SRFSEFGGGALQGQE-QEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
pt028965_POPTR_ SKMTQ------------------LESASSGFTVLRNKAPRWHEHLQCWCLNFHGRVTVAS
pt000709_POPTR_ SRFSNIVGP-----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVAS
pt037559_POPTR_ PSPSQ-SPV--------------LTQGSEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
gm003395_Glyma0 SRFSDIFVA-----------GNEEEQGKGRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
gm045745_Glyma1 -SLENSISGDQSN-------------KKDDVLVLRNKAARWHEQLQCWCLNFHGRVTIAS
gm028527_Glyma1 SRFSDIMGT-----------GIEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVAS
Os009471_Os02t0 TSLSADLSG--------------PVCTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
pt002868_POPTR_ SRFSDIVGP-----------R-EDEEGKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
gm039266_Glyma1 TGTDN-TPE--------------SIQRAREPLILKNKAPRWHEQLQCWCLNFKGRVTVAS
pp005711_Pp1s21 STLD-YDFASGLL-------------AKDEPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
gm003133_Glyma0 ASLSE-PPV--------------LSQGSTEQLALKNKAPRWHEQLQCWCLNFKGRVSVAS
gm034540_Glyma1 HKMHD------------------KEQAASGYTILKNKAPRWHEHLQCWCLNFHGRVTVAS
gm044675_Glyma1 ASLSE-PPV--------------SSQCSAEQLALKNRAPRWHEQLQCWCLNFKGRVSVAS
Sm008088_Selmo1 ---------------------------KGDPLVLKNKSPRWHDQLQCWCLNFRGRVTVAS
gm001764_Glyma0 ASLPELLPV--------------QSQDSAEPLVLKNKAPRWHEQLQCWCLNFNGRVTVAS
pt001281_POPTR_ ASPSR-SPV--------------LAQGSEELLVLKNKAPRWHEQLQCSCLNFRGRVTVAS
Os029491_Os07t0 -RANNS-TASLLT-------------QNGSKLVLKNKSPRWHEHLQCWCLNFHGRVTVAS
Os040209_Os12t0 SRYSDISVGGPMVGG---QALGDSDESKERPLILRNKAPRWHEQLQCWCLNFKGRVTVAS
                                                 *:*: ..**: *:* ****.***::**

AT2G18280.1     VKNFQLVAEIDA---------------------------------------SLDAPP---
gm021742_Glyma0 VKNFQLIAAT----QPPA-----GA----------------------PTP-SQPAP----
Sm012016_Selmo1 VKNFQLVAALE--------------------------------------P-GQQAH----
gm021743_Glyma0 VKNFQLIAAT----QPPA-----GA----------------------PTP-SQPAP----
Os021774_Os05t0 VKNFQLIAAPA---QPPA-----GA----------------------PTP-SQPAP----
pt000712_POPTR_ VKNFQLVAAT----QPAA-----GA----------------------PTP-SQPAQ----
gm041219_Glyma1 VKNFQLIAAT----QPAA-----GA----------------------PTP-SQPAP----
Os021773_Os05t0 VKNFQLIAAPA---QPPA-----GA----------------------PTP-SQPAP----
Os029490_Os07t0 VKNFQLVASDES-----------N-----------------------------PTN----
pp034759_Pp1s15 VKNFQLVAA-----------------TSVKAVSAAATT--------------SSSS----
gm045744_Glyma1 VKNFQLAVSPEN-----------G-----------------------------HAG----
Os029803_Os08t0 VKNFQLIAAA-------------------------------------SSESSQLEQQQQQ
gm003397_Glyma0 VKNFQLIAAT----QPPA----AGA----------------------PTPSSQPAQ----
Os009468_Os02t0 VKNFQLVASVDP---------------------------------------SLGIPA---
pp000633_Pp1s10 VKNFQLVAATDL-------------------------------------P-PTNSQ----
pt001717_POPTR_ VKNFQLVAAVEP---------------------------------------CQNVPV---
Sb028483_Sorbi1 VKNFQLVAAVMT--QPAV-----GA----------------------PTP-SQAAP----
gm044960_Glyma1 VKNFQLIAAT----QPPA----TGA----------------------PTPSSQPAQ----
pt041132_POPTR_ VKNFQLVVSPEN-----------G-----------------------------PAG----
gm054929_Glyma2 VKNFQLIAAT----PPPAIVTTGTG----------------------PTP-SQPTQS---
Os004869_Os01t0 VKNFQLVAAPS---PPPA-----GA----------------------PTP-SQPGP----
gm030081_Glyma1 VKNFQLVSAVDP---------------------------------------SHNVSA---
gm048089_Glyma1 VKNFQLVAAAEP---------------------------------------CQNVSA---
Os019649_Os04t0 VKNFQLIAAAP---QPSS-----GAAS-------------------EPSQAGQAAQQQTQ
Sb027814_Sorbi1 VKNFQLVASVDP---------------------------------------SLNIPA---
pp034735_Pp1s15 VKNFQLVAA-----------------TSVKAVSAAATT--------------SSSS----
gm039265_Glyma1 VKNFQLVAAAEP---------------------------------------CQNVSA---
pt034249_POPTR_ VKNFQLVASQEN-----------G-----------------------------PAG----
Sb024300_Sorbi1 VKNFQLVASGES-----------D-----------------------------LNN----
gm054928_Glyma2 VKNFQLIAAT----PPPAIVTTGTG----------------------PTP-SQPTQS---
Sb032660_Sorbi1 VKNFQLIAAPSPAPAPAA-----RA----------------------PTPSSQPVP----
gm021740_Glyma0 VKNFQLIAAT----QPPA-----GA----------------------PTP-SQPAP----
gm041730_Glyma1 VKNFQLVASAEN-----------R-----------------------------PAG----
gm045746_Glyma1 VKNFQLAVSPEN-----------G-----------------------------HAG----
gm003396_Glyma0 VKNFQLIAAT----QPPA----AGA----------------------PTPSSQPAQ----
gm044959_Glyma1 VKNFQLIAAT----QPPA----TGA----------------------PTPSSQPAQ----
gm004126_Glyma0 VKNFQLVASPKN-----------G-----------------------------VSE----
pt000710_POPTR_ VKNFQLVAAT----QPAA-----GA----------------------PTP-SQPAQ----
pp034734_Pp1s15 VKNFQLVAA-----------------TSVKAVSAAATT--------------SSSS----
pp022942_Pp1s22 VKNFQLVAATTS-----------STTTSTTAGEAAAATGGGGGAGAATPA-PTSSG----
gm021741_Glyma0 VKNFQLIAAT----QPPA-----GA----------------------PTP-SQPAP----
gm036751_Glyma1 VKNFQLVASAEN-----------G-----------------------------PAG----
Sm016835_Selmo1 VKNFQLVAATEI-----------G------------------------QP-PQPS-----
gm028526_Glyma1 VKNFQLIAST----PPAAVAPTGTG----------------------PTP-SQPTQS---
pp022947_Pp1s22 VKNFQLVAATTS-----------STTTSTTAGEAAAATGGGGGAGAATPA-PTSSG----
pt000711_POPTR_ VKNFQLVAAT----QPAA-----GA----------------------PTP-SQPAQ----
pt037558_POPTR_ VKNFQLVAAVES---------------------------------------FHNVSS---
gm037352_Glyma1 VKNFQLVATVDQ---------------------------------------SQPGGK---
gm019438_Glyma0 VKNFQLAVSPEN-----------G-----------------------------HAG----
pt039357_POPTR_ VKNFQLIAAT----QPAA-----GA----------------------PTP-SQPAQ----
pt037730_POPTR_ VKNFQLVAAVEP---------------------------------------CQNVPV---
gm030080_Glyma1 VKNFQLVSAVDP---------------------------------------SHNVSA---
Os019651_Os04t0 VKNFQLIAAAP---QPSS-----GAAS-------------------EPSQAGQAAQQQTQ
pt028965_POPTR_ VKNFQLVAIMDQ---------------------------------------SQPGGK---
pt000709_POPTR_ VKNFQLVAAT----QPAA-----GA----------------------PTP-SQPAQ----
pt037559_POPTR_ VKNFQLVAAVES---------------------------------------FHNVSS---
gm003395_Glyma0 VKNFQLIAAT----QPPA----AGA----------------------PTPSSQPAQ----
gm045745_Glyma1 VKNFQLAVSPEN-----------G-----------------------------HAG----
gm028527_Glyma1 VKNFQLIAST----PPAAVAPTGTG----------------------PTP-SQPTQS---
Os009471_Os02t0 VKNFQLVASVDP---------------------------------------SLGIPA---
pt002868_POPTR_ VKNFQLIAAT----QPAA-----GA----------------------PTP-SQPVQ----
gm039266_Glyma1 VKNFQLVAAAEP---------------------------------------CQNVSA---
pp005711_Pp1s21 VKNFQLVASMES-------------------------------------L-PTSSQ----
gm003133_Glyma0 VKNFQLVAAVDP---------------------------------------SHNISA---
gm034540_Glyma1 VKNFQLVATVDQ---------------------------------------SQPGGK---
gm044675_Glyma1 VKNFQLVAAVDP---------------------------------------SHNISA---
Sm008088_Selmo1 VKNFQLVAAADQ------------------------------------PP-APVCQ----
gm001764_Glyma0 VKNFQLVAAVDP---------------------------------------SHNVSA---
pt001281_POPTR_ VKNFQLVASAEP---------------------------------------SHNVPA---
Os029491_Os07t0 VKNFQLVASDES-----------N-----------------------------PTN----
Os040209_Os12t0 VKNFQLVAAT----QPAA-----GA----------------------PTP-SQPAPP---
                ******                                                      

AT2G18280.1     ------------EEHERVILQFGKIGKDIFTMDYRYPLSAFQAFAICISSFDTK--PACE
gm021742_Glyma0 ------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
Sm012016_Selmo1 ------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFGICLSSFDTK--LACE
gm021743_Glyma0 ------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
Os021774_Os05t0 ------------PEQDKIILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pt000712_POPTR_ ------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm041219_Glyma1 ------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
Os021773_Os05t0 ------------PEQDKIILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
Os029490_Os07t0 ------------QEHDDVILQFGKVGKDMFTMDYRYPISAFQAFAICLSSFDTK--IACE
pp034759_Pp1s15 ------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm045744_Glyma1 ------------LQEDEVILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE
Os029803_Os08t0 QQQNHASSSSSASDHGKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
gm003397_Glyma0 ------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE
Os009468_Os02t0 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTK--PACE
pp000633_Pp1s10 ------------NDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pt001717_POPTR_ ------------EEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
Sb028483_Sorbi1 LPLPAPAPGPPLPDQEKVLLQFGKVGKDIFTMDYCYPLSAFQAFAICLSSFDTK--LACE
gm044960_Glyma1 ------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE
pt041132_POPTR_ ------------PEHENIILQFGKVGKDLFTMDYRYPISAFQAFALCLSSFDTK--IACE
gm054929_Glyma2 -----------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
Os004869_Os01t0 ------------ADPEKVILQFGKVARDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm030081_Glyma1 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
gm048089_Glyma1 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
Os019649_Os04t0 PSQPSSSSSSSSSNHDTVILQFGKVAKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
Sb027814_Sorbi1 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTK--PACE
pp034735_Pp1s15 ------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm039265_Glyma1 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
pt034249_POPTR_ ------------PEHENIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTK--IACE
Sb024300_Sorbi1 ------------QGDDDVILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTK--ITRE
gm054928_Glyma2 -----------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
Sb032660_Sorbi1 ------------QDQDKIILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm021740_Glyma0 ------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm041730_Glyma1 ------------PEHDKIILQFGKVGKDLFTMDYRFPISAFQAFAICLSSFDTK--IACE
gm045746_Glyma1 ------------LQEDEVILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE
gm003396_Glyma0 ------------SDHDKIILQFGK--QTIYVL---LPCSVMGFFLW--------------
gm044959_Glyma1 ------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE
gm004126_Glyma0 ------------QAQENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTK--IACE
pt000710_POPTR_ ------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pp034734_Pp1s15 ------------ADHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pp022942_Pp1s22 ------------SDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm021741_Glyma0 ------------PEHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm036751_Glyma1 ------------PEHDKIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTK--IACE
Sm016835_Selmo1 -------------DPDNVILQFGKIGKDTFTMDYRYPLSAFQAFAISLSSFDTKDSLHCT
gm028526_Glyma1 -----------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
pp022947_Pp1s22 ------------SDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pt000711_POPTR_ ------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pt037558_POPTR_ ------------ADQERVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
gm037352_Glyma1 ------------GDEETVLLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTK--LACE
gm019438_Glyma0 ------------PQEDEVILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE
pt039357_POPTR_ ------------SDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pt037730_POPTR_ ------------EEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
gm030080_Glyma1 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
Os019651_Os04t0 PSQPSSSSSSSSSNHDTVILQFGKVAKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
pt028965_POPTR_ ------------GDEETVLLQFGKVGDDTFTMDYRQPLSAFQAFALCLTSFGTK--LACE
pt000709_POPTR_ ------------SDHDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
pt037559_POPTR_ ------------ADQERVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
gm003395_Glyma0 ------------SDHDKIILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE
gm045745_Glyma1 ------------LQEDEVILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE
gm028527_Glyma1 -----------SSDPDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE
Os009471_Os02t0 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTK--PACE
pt002868_POPTR_ ------------SDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm039266_Glyma1 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
pp005711_Pp1s21 ------------SDRDKVLLQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm003133_Glyma0 ------------EEQEKVILQFGKIGKDIFTMDYCYPLSTFQAFAICLSSFDTK--PACE
gm034540_Glyma1 ------------GDEETVLLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTK--LACE
gm044675_Glyma1 ------------EEQEKVILQFGKIGKDIFTMDYCYPLSTFQAFAICLSSFDTK--PACE
Sm008088_Selmo1 ------------GEQDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
gm001764_Glyma0 ------------AEQEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE
pt001281_POPTR_ ------------ADQERVILQFGKIGKDIFTMDYFYPLSAFQAFAICLSSFDTK--PACE
Os029491_Os07t0 ------------QEHDDVILQFGKVGKDMFTMDYRYPISAFQAFAICLSSFDTK--IACE
Os040209_Os12t0 ----------PPPDHDKVILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE
                                 ::*****     :.:    * *.:  *                

AT2G18280.1     G----
gm021742_Glyma0 -----
Sm012016_Selmo1 -----
gm021743_Glyma0 -----
Os021774_Os05t0 -----
pt000712_POPTR_ -----
gm041219_Glyma1 -----
Os021773_Os05t0 -----
Os029490_Os07t0 -----
pp034759_Pp1s15 -----
gm045744_Glyma1 -----
Os029803_Os08t0 -----
gm003397_Glyma0 -----
Os009468_Os02t0 -----
pp000633_Pp1s10 -----
pt001717_POPTR_ -----
Sb028483_Sorbi1 -----
gm044960_Glyma1 -----
pt041132_POPTR_ -----
gm054929_Glyma2 -----
Os004869_Os01t0 -----
gm030081_Glyma1 -----
gm048089_Glyma1 -----
Os019649_Os04t0 -----
Sb027814_Sorbi1 -----
pp034735_Pp1s15 -----
gm039265_Glyma1 -----
pt034249_POPTR_ -----
Sb024300_Sorbi1 -----
gm054928_Glyma2 -----
Sb032660_Sorbi1 -----
gm021740_Glyma0 -----
gm041730_Glyma1 -----
gm045746_Glyma1 -----
gm003396_Glyma0 -----
gm044959_Glyma1 -----
gm004126_Glyma0 -----
pt000710_POPTR_ -----
pp034734_Pp1s15 -----
pp022942_Pp1s22 -----
gm021741_Glyma0 -----
gm036751_Glyma1 -----
Sm016835_Selmo1 YALMF
gm028526_Glyma1 -----
pp022947_Pp1s22 -----
pt000711_POPTR_ -----
pt037558_POPTR_ -----
gm037352_Glyma1 -----
gm019438_Glyma0 -----
pt039357_POPTR_ -----
pt037730_POPTR_ -----
gm030080_Glyma1 -----
Os019651_Os04t0 -----
pt028965_POPTR_ -----
pt000709_POPTR_ -----
pt037559_POPTR_ -----
gm003395_Glyma0 -----
gm045745_Glyma1 -----
gm028527_Glyma1 -----
Os009471_Os02t0 -----
pt002868_POPTR_ -----
gm039266_Glyma1 -----
pp005711_Pp1s21 -----
gm003133_Glyma0 -----
gm034540_Glyma1 -----
gm044675_Glyma1 -----
Sm008088_Selmo1 -----
gm001764_Glyma0 -----
pt001281_POPTR_ -----
Os029491_Os07t0 -----
Os040209_Os12t0 -----
                     


BoxShade v3.31 C (beta, 970507) Output
AT2G18280.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
gm021742_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Sm012016_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S S S S S S L L P L
gm021743_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os021774_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt000712_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os021773_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os029490_Os07t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pp034759_Pp1s15    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P L
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I E V
Os029803_Os08t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm003397_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os009468_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
pp000633_Pp1s10    M L A S E C L T V H G L R R W L K L W L I L L K R S L E G I W C E V S R R E L G F C K W T M S G Q K S - - - S S M M P L
pt001717_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Sb028483_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm044960_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt041132_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S A I
gm054929_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os004869_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
gm048089_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P F
Os019649_Os04t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Sb027814_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - A A M S L
pp034735_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S - - G S S M M P L
gm039265_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P F
pt034249_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P A L
Sb024300_Sorbi1    - - A E E C - - - - - - - - - - - - - - - - - - - - - - - - S C G G G G - - - G F - - W R V G G R E R - Q A S G D M P F
gm054928_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Sb032660_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - L A K M S F
gm021740_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M C L I
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I E V
gm003396_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm044959_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm004126_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt000710_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pp034734_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S - - G S S M M P L
pp022942_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P L
gm021741_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M G L I
Sm016835_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S - - - S T L T P L
gm028526_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000711_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt037558_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S I
gm037352_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt039357_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt037730_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm030080_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
Os019651_Os04t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt028965_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
pt000709_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
pt037559_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S I
gm003395_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I E V
gm028527_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os009471_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt002868_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
gm039266_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P F
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003133_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
gm034540_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
gm044675_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S L
pt001281_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os029491_Os07t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
Os040209_Os12t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F
 
AT2G18280.1     K S I L R D L K E V R D G L G G I S K R - - - - - - - - - - - - - - - - - - - S W S K S S H I - - A P D Q T T P P L D N
gm021742_Glyma0    R S I V - - - R D V R D S F G S L S R R - - - S F D V R - - - - - - - L T G H H R G K S Q G S - - V Q D L H D Q P L - -
Sm012016_Selmo1    R S I L R E F Q D I R D G I G S L S R R - - - S F E V R - - - - - - - L P Y H H R S R S H S V - - V L D - - - - - - - -
gm021743_Glyma0    R S I V - - - R D V R D S F G S L S R R - - - S F D V R - - - - - - - L T G H H R G K S Q G S - - V Q D L H D Q P L - -
Os021774_Os05t0    R S I V - - - R D V R D S F G S L S R R - - - S F E V T L A G L - S G L T G H H R G K S Q S T - - V H E L C D A D L - -
pt000712_POPTR_    R S I V - - - R D M R D G F G S L S R R - - - S F E V R - - - - - - - L P G H F R G K S H G S - - A C E L L D Q P V - -
gm041219_Glyma1    R S I V - - - R D V R D S F G S L S R R - - - S F D V R - - - - - - - L T G H H R G K S Q G S - - V Q D L H D Q P L - -
Os021773_Os05t0    R S I V - - - R D V R D S F G S L S R R - - - S F E V T L A G L - S G L T G H H R G K S Q S T - - V H E L C D A D L - -
Os029490_Os07t0    R S V I - - - Q E V K G E I G A I S R R - - - G F - - - - - - - - - - - - - - - R S R P G R V R R V A A A A E E P P - -
pp034759_Pp1s15    K S L I R E F Q E M K G G R G G I S R R - - - S F E L K - - - - - - - F P H H H K G R S S G M - - V L D - - - - - - - -
gm045744_Glyma1    Q A N - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029803_Os08t0    R S I V - - - R D V R D S F G S L S R R - - - S F E V R I S G L - P G L S G H H R G K S L G S - - L S E L R D R P V - -
gm003397_Glyma0    R S I V - - - R D V R D G F G S L S R R - - - S F D V R - - - - - - - I S G G - - G K L N S L - - V H E A H E R Q L - -
Os009468_Os02t0    K S I V R E L R E M R D G I G S M S R R - - - A A D G R - - - - - - - - A G G G R G G S R H S - - W P V L W S E Q Q Q P
pp000633_Pp1s10    K S L I R E F Q E M K G G I G N I S R R - - - S F E L K - - - - - - - F P H H H R G R S S G M - - V L D - - - - - - - -
pt001717_POPTR_    K S - - - K L K E I R D D I T T T F S M G - - K L Q R N - - - - - - - - R T N R R G R A - Y I - - A P E L - - - - - - -
Sb028483_Sorbi1    R S I V - - - R D V R D G F G S L S R R - - - G F E V R - - - - - - - F L S P R R G K S H G A - - V H E L H D P V P - -
gm044960_Glyma1    R S I V - - - R D V R D G F G S L S R R - - - S F D V R - - - - - - - L S G G - - G K S N S L - - V H E E H E C L P - -
pt041132_POPTR_    K S I I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - N R S R S H R - - - V V Q Y S S A P D - -
gm054929_Glyma2    R S I V - - - R D V R D G F G S L S R R - - - S F E V R - - - - - - - L P G H N R G K S R S S - - V H E L Q D Q P P - -
Os004869_Os01t0    R S I V - - - R D V R D G F G S L S R R - - - S F E V T L A S L - Y G L T G H H K G K T Q S S - - L D E L D D S P A - -
gm030081_Glyma1    K S I V R E L K E M R D G I G S M S R R - - - G V E S R - - - - - - - - R W N G R T K S - H V - - A P D V T L T S L E P
gm048089_Glyma1    R S I V R E L K E I G E G I S N M Y R R - - - G G E A K - - - - - - - - H V H R H G K S - H I - - A P E C S L P P P P S
Os019649_Os04t0    R S I V - - - R D F R D S F G T L S K R - - - S F E V K I S - - - - G F S G R H R G K S I G P - - S S E L D D T P V - -
Sb027814_Sorbi1    K S I V R E L K E M R D G I G S M S R R G G S G S D G R - - - - - - - - A G H G R S G S R H S - - W P S L W A E Q Q Q P
pp034735_Pp1s15    K S L I R E F Q E M K G G R G G I S R R - - - S F E L K - - - - - - - F P H H H K G R S S G M - - V L D - - - - - - - -
gm039265_Glyma1    R S I V R E L K E I G E G I S N M Y R R - - - G G E A K - - - - - - - - H V H R H G K S - H I - - A P E C S L P P P P P
pt034249_POPTR_    K S I I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - N R S T S H R - - - V V Q Y S S A P E - -
Sb024300_Sorbi1    S S M I - - - H E M K G E I G A I S S R - - - G L - - - - - - - - - - - - - - L R F R S G G H - - A A A A G R A - - - -
gm054928_Glyma2    R S I V - - - R D V R D G F G S L S R R - - - S F E V R - - - - - - - L P G H N R G K S R S S - - V H E L Q D Q P P - -
Sb032660_Sorbi1    R S I V - - - R D V R D S F G S L S R R - - - S F E V T I A G L - S G L T V H H R G K S Q S T - - V H E V C D T D L - -
gm021740_Glyma0    R S I V - - - R D V R D S F G S L S R R - - - S F D V R - - - - - - - L T G H H R G K S Q G S - - V Q D L H D Q P L - -
gm041730_Glyma1    R S M - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S Q S Q R - - - V V Q E Q E E A E - -
gm045746_Glyma1    Q A N - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    R S I V - - - R D V R D G F G S L S R R - - - S F D V R - - - - - - - I S G G - - G K L N S L - - V H E A H E R Q L - -
gm044959_Glyma1    R S I V - - - R D V R D G F G S L S R R - - - S F D V R - - - - - - - L S G G - - G K S N S L - - V H E E H E C L P - -
gm004126_Glyma0    R S I I - - - L E - - - - - - - - - R K - - - G F E V K - - - - - - - F G Y S M R S R S Q - - - - - - S H S D A I A - -
pt000710_POPTR_    R S I V - - - R D M R D G F G S L S R R - - - S F E V R - - - - - - - L P G H F R G K S H G S - - A C E L L D Q P V - -
pp034734_Pp1s15    K S L I R E F Q E M K G G R G G I S R R - - - S F E L K - - - - - - - F P H H H K G R S S G M - - V L D - - - - - - - -
pp022942_Pp1s22    K S L I R E F Q E M K G G I G N I S R R - - - S F E L K - - - - - - - F P H H H K G R S S G M - - V L D - - - - - - - -
gm021741_Glyma0    R S I V - - - R D V R D S F G S L S R R - - - S F D V R - - - - - - - L T G H H R G K S Q G S - - V Q D L H D Q P L - -
gm036751_Glyma1    R S M - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S R S Q R - - - V V Q E Q E A A E - -
Sm016835_Selmo1    W S V I - - - Q D I K - G I G S I S R R - - - S F E V K - - - - - - - L P T Y S R S R S H S A - - A Q D A A G R H Q F -
gm028526_Glyma1    R S I V - - - R E V R D G F G S L S R R - - - S F E V R - - - - - - - L P G H N R G K S R S L - - V H E L Q D Q P P - -
pp022947_Pp1s22    - - - - - - - - - M K G G I G N I S R R - - - S F E L K - - - - - - - F P H H H K G R S S G M - - V L D - - - - - - - -
pt000711_POPTR_    R S I V - - - R D M R D G F G S L S R R - - - S F E V R - - - - - - - L P G H F R G K S H G S - - A C E L L D Q P V - -
pt037558_POPTR_    K S I V R E L K E M K D G I G N I S R R - - - G L E G K - - - - - - - - H W R G R A R S - H I - - A P D E T P A E T D Q
gm037352_Glyma1    R K V F - - - - - - - - - - - - R S R K F S R S F K E V L P A E G A A I V G G E D G - V A G A - - G E E S S N G - N - -
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt039357_POPTR_    R S I V - - - R D M R D G F G S L S R R - - - S F E V R - - - - - - - L P G H L R G K S H G S - - A C E L Q D Q P V - -
pt037730_POPTR_    K G - - - K L K E I R D D I S T T F S M G - - K L Q R N - - - - - - - - R T N R R G R A - Y I - - A P E L - - - - - - -
gm030080_Glyma1    K S I V R E L K E M R D G I G S M S R R - - - G V E S R - - - - - - - - R W N G R T K S - H V - - A P D V T L T S L E P
Os019651_Os04t0    R S I V - - - R D F R D S F G T L S K R - - - S F E V K I S - - - - G F S G R H R G K S I G P - - S S E L D D T P V - -
pt028965_POPTR_    R R S F - - - - - - - - - - - - L S R R F S R S F N N Q N R N E R N G V - - - E S G R L V G - - - - - - E S G G E S - -
pt000709_POPTR_    R S I V - - - R D M R D G F G S L S R R - - - S F E V R - - - - - - - L P G H F R G K S H G S - - A C E L L D Q P V - -
pt037559_POPTR_    K S I V R E L K E M K D G I G N I S R R - - - G L E G K - - - - - - - - H W R G R A R S - H I - - A P D E T P A E T D Q
gm003395_Glyma0    R S I V - - - R D V R D G F G S L S R R - - - S F D V R - - - - - - - I S G G - - G K L N S L - - V H E A H E R Q L - -
gm045745_Glyma1    Q A N - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028527_Glyma1    R S I V - - - R E V R D G F G S L S R R - - - S F E V R - - - - - - - L P G H N R G K S R S L - - V H E L Q D Q P P - -
Os009471_Os02t0    - - - - - - - - - M R D G I G S M S R R - - - A A D G R - - - - - - - - A G G G R G G S R H S - - W P V L W S E Q Q Q P
pt002868_POPTR_    R S I V - - - R D M R D G F G S L S R R - - - S F E V R - - - - - - - L P G H H R G K S H S S - - A C E L H D Q P V - -
gm039266_Glyma1    R S I V R E L K E I G E G I S N M Y R R - - - G G E A K - - - - - - - - H V H R H G K S - H I - - A P E C S L P P P P P
pp005711_Pp1s21    - - - - - - - - - M K S G V G R I S R R - - - S F E L K - - - - - - - F P H H H R G R S S G M - - V L D - - - - - - - -
gm003133_Glyma0    R S I V R E L K E M R D G I G S T S K R - - - G A E S K - - - - - - - - H R L S R T K S - H V - - A P D V L A T P F E P
gm034540_Glyma1    R K V F - - - - - - - - - - - - R S R K F S K S F K E V L P A E G A A V - - - E G G - V A G T - - V E E A A N G N N - -
gm044675_Glyma1    R S I V R E L K E M R D G I G S T S K R - - - G A E S K - - - - - - - - H W L S R T K S - H V - - A P D I L A T P F E P
Sm008088_Selmo1    - - - - - - - - - - - - - - - - M S R - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    K S I V R E L K E M R D G I G S M S R R - - - G V E S R - - - - - - - - R W N G R T K S - H V - - A P D V I L T S L E P
pt001281_POPTR_    K S I M R E F K E I K E G I G S I S R R - - - G V E G K - - - - - - - - H W C G R V R S - H I - - A P D E T R E E T D Q
Os029491_Os07t0    R S V I - - - Q E V K G E I G A I S R R - - - G F - - - - - - - - - - - - - - - R S R P G R V R R V A A A A E E P P - -
Os040209_Os12t0    R S I V - - - R D V R D G F G S L S R R - - - G F E V R - - - - - - - L V G H R R G R S H S A - - V H E L R D G H A A -
 
AT2G18280.1     I P Q S P - - - - - - - - - - - - W A S L P P E L L H D I I W R V E E S E T A W P A R A A V V S C A S V C K S W - R G I
gm021742_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M
Sm012016_Selmo1    - - E P P V R D V V V L Q Q - S R W A S M P P E L L R D V I Q R L E S S E H T W P A R K N V V V C A E V C S Q W - R D I
gm021743_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M
Os021774_Os05t0    - - - - - - - - - - I I Q E - S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W - R E M
pt000712_POPTR_    - - - - - - - - - - V I Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M
gm041219_Glyma1    - - - - - - - - - - V I Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M
Os021773_Os05t0    - - - - - - - - - - I I Q E - S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W - R E M
Os029490_Os07t0    - - D E S S A A A L V M R E - S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W - R G I
pp034759_Pp1s15    - - E S Q L R V E A V V K Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W - R E I
gm045744_Glyma1    - - - - - - - - - - A M E Q - S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I
Os029803_Os08t0    - - - - - - - - - - V V D Q - S R W V G L P P E L L R D V M K R L E E G E S N W P S R K D V V A C A A V C R T W - R E I
gm003397_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M
Os009468_Os02t0    P Q Q Q Q L Q R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W - R E V
pp000633_Pp1s10    - - E S Q L R P E R V V E Q - S C W A N M P P E L L R D V I Q R V E V S E S T W P S R K H V V A C A A V C S S W - R E I
pt001717_POPTR_    - G G G S E L L S E L I E E Q S P W A N L P P E L L Q D V I K R V E G S E T S W P G R R D V V A C A S V C T S W - R E I
Sb028483_Sorbi1    - - - - - - - - - - V V Q S - S C W A S L P P E L L R D V I E R L E T S E D T W P S R K H V V A C A A V C R T W - R E M
gm044960_Glyma1    - - - - - - - - - - V V Q N - S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V V A C A A V C R S W - R G M
pt041132_POPTR_    - - L S L F G G G C G A E T T S C W A N L P Q E L L R E V L I R I E E S E S S W P P R K N V V A C A G V C R S W - R D I
gm054929_Glyma2    - - - - - - - - - - V I Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M
Os004869_Os01t0    - - - - - - - - - - I I P E - S R W A S L P P E L L R E V I R R L E A D E S T W P S R R N V V C F A A V C R T W - R E M
gm030081_Glyma1    I Q Q G H - - - - - - - - - - - - W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V
gm048089_Glyma1    S S S S S S S S S - - - S W Q S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C K L W - R E I
Os019649_Os04t0    - - - - - - - - - - V A Q Q - S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W - R D M
Sb027814_Sorbi1    Q R Q G Q E G P Q H Q H Q H Q G R W A N L P P E L L L D V I Q R V E S S E A T W P A R R Q V V A C A A V C R S W - R E V
pp034735_Pp1s15    - - E S Q L R V E A V V K Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W - R E I
gm039265_Glyma1    P P P S S S S - - - - - - - Q S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C R L W - R E I
pt034249_POPTR_    - - L N L F A A G G A A E T A S C W A N L P Q E L L R E V L V R I E E S E S S W P P R K N V V A C A G V C R S W - R H I
Sb024300_Sorbi1    - - S A A A E P D E A L R E - S C W A R V P P E L L R M V L A R V E H E E A R W P G R S A V V A S A G V C R C W - R A V
gm054928_Glyma2    - - - - - - - - - - V I Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M
Sb032660_Sorbi1    - - - - - - - - - - I I Q E - S R W A N L P P E L L R D V I R R L E A S E S T W P N R K H V V S C A A V C R A W - R E M
gm021740_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M
gm041730_Glyma1    - - C - - - - V G D S M R Q - S C W A N M P Q E L L R E V L F R I E A S E D A W P P R K S V V A C A G V C R S W - R Q I
gm045746_Glyma1    - - - - - - - - - - A M E Q - S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I
gm003396_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M
gm044959_Glyma1    - - - - - - - - - - V V Q N - S R W A S L P P E L L R D V I K R L E E S E T T W P A R K H V V A C A A V C R S W - R G M
gm004126_Glyma0    - - Q D S L V V L D G L K Q - S C W A N M P P E L L R D V L M R I E A S E D S W P A Q K H V V A C A G V C R S W - R E I
pt000710_POPTR_    - - - - - - - - - - V I Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M
pp034734_Pp1s15    - - E S Q L R V E A V V K Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P G R K H V V A C A A V C S S W - R E I
pp022942_Pp1s22    - - E S Q L R A E P V V E Q - S C W A N M P P E L L R D V I Q R V E A S E N A W P S R K H V V A C A A V C S S W - R E I
gm021741_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L F D I I R R L E E S E N T W P A R K H V V A C A A V C Q S W - R N M
gm036751_Glyma1    - - C V G V V V G D S M R Q - S C W A N M P Q E L L R E V L L R I E A S E D T W P P R K S V V S C A G V C R S W - R H I
Sm016835_Selmo1    - G E S G - - - - - - - Q Q - S R W A N M P P E L L R D V I Q R V E A S D K M W P S R K S V V A C A A V C R N W - R K I
gm028526_Glyma1    - - - - - - - - - - V I Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M
pp022947_Pp1s22    - - E S Q L R A E P V V E Q - S C W A N M P P E L L R D V I Q R V E A S E N A W P S R K H V V A C A A V C S S W - R E I
pt000711_POPTR_    - - - - - - - - - - V I Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M
pt037558_POPTR_    I E Q G Q - - - - - - - - - - - - W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W - R E I
gm037352_Glyma1    - - - - - - - - - - - - - - - N G W S N M L P E I L G E I V R R V D A A E E Q W P N R Q N V V A C A C V C K R W - R D I
gm019438_Glyma0    - - - - - - - - - - - M E Q - S W R A N M P R E L L R E V L L R I E S S E A T W P S R R S V V A C G G V C R T W - R L I
pt039357_POPTR_    - - - - - - - - - - V I Q N - S R W A G L P P E L L Q D V I K R L E A S E S T W P S R K H V V A C A S V C R A W - R E M
pt037730_POPTR_    - G G G S E L F R E L I E E Q S P W A N L P P E L L H D V I Q R V E G S E T S W P G R R D V V A C A S V C K S W - R E I
gm030080_Glyma1    I Q Q G H - - - - - - - - - - - - W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V
Os019651_Os04t0    - - - - - - - - - - V A Q Q - S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W - R D M
pt028965_POPTR_    - - - - - - - - - - - - - - - D G W G S M L P E L L G E I I K R V E E S E D R W P Q R Q N V V A C A C V C K K W - R E V
pt000709_POPTR_    - - - - - - - - - - V I Q D - S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W - R E M
pt037559_POPTR_    I E Q G Q - - - - - - - - - - - - W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W - R E I
gm003395_Glyma0    - - - - - - - - - - V I Q N - S R W A S L P P E L L C D V I K R L E E S E S T W P A R K H V V A C A A V C K S W - R E M
gm045745_Glyma1    - - - - - - - - - - A M E Q - S W W A N M P H E L L R E V L L R I E S S E S T W P L R R S V V A C G G V C R T W R R L I
gm028527_Glyma1    - - - - - - - - - - V I Q N - S R W A S L P P E L L R D V I N R L E A S E S T W P G R K H V V A C A A V C K S W - R E M
Os009471_Os02t0    P Q Q Q Q L Q R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W - R E V
pt002868_POPTR_    - - - - - - - - - - V I Q N - S R W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A A V C S A W - R E M
gm039266_Glyma1    P P P S S S S - - - - - - - Q S R W A N L P P E L L L D I I Q R L E A S E T S W P A R R A L V A C A S V C R L W - R E I
pp005711_Pp1s21    - - E S Q L N S E P V V E Q - S C W A N M P P E L L R D V I Q R V E A S E S A W P S R K H V V A C A A V C S S W - R E V
gm003133_Glyma0    I Q Q G Q - - - - - - - - - - - - W A N L P S E L L L D I I Q R V E E S E T S W P A R A V V V F C A S V C K S W - R S I
gm034540_Glyma1    - - - - - - - - - - - - - - - N G W S S M L P E I L G E I V R R V D A A E E Q W P N R Q N V V A C A C V C K R W - R D I
gm044675_Glyma1    I Q Q G Q - - - - - - - - - - - - W A N L P S E L L L D I I Q R I E E S E T S W P A R A V V V F C A S V C K S W - R S I
Sm008088_Selmo1    - - - - - - - - - - - - - Q - S C W A N M P P E L L R D I I Q R L E S S D N V W P S R K N V V A C A A V C S T W - R E I
gm001764_Glyma0    I Q Q G Q - - - - - - - - - - - - W A N L P P E L L L D I I R R V E D S E T T W P A R A V V V Y C G S V C K S W - R A V
pt001281_POPTR_    I D Q G Q - - - - - - - - - - - - W A N L P P E L L L D I I M R L E E S E S S W P A R V V V V H C A S V C R S W - R E I
Os029491_Os07t0    - - D E S S A A A L V M R E - S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W - R G I
Os040209_Os12t0    - - - - - A A A A D V V Q S - S C W A N L P P E L L R D V I E R L E A S E A A W P S R K N V V A C A A V C R T W - R D M
 
AT2G18280.1     T M E I V R - I P E Q - - - - - - C G K L T F P I S L K Q P G P R D S P I Q C F I K R N R A T A T Y I L Y Y G L M P S -
gm021742_Glyma0    C K D I V K - S P E F - - - - - - C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A -
Sm012016_Selmo1    A K E L V K - T P E Q - - - - - - S G K L T F P I S L K Q P G P R D A T M Q C F I K R D R A T S T Y H L C L G L S P N F
gm021743_Glyma0    C K D I V K - S P E F - - - - - - C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A -
Os021774_Os05t0    C K E I V L - S P E F - - - - - - C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A -
pt000712_POPTR_    C K E I V R - S P E F - - - - - - S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A -
gm041219_Glyma1    C K D I V K - S P E F - - - - - - C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A -
Os021773_Os05t0    C K E I V L - S P E F - - - - - - C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A -
Os029490_Os07t0    V R E I V R - T P E A - - - - - - S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A -
pp034759_Pp1s15    T K E L V R - T P E Q - - - - - - S G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P T -
gm045744_Glyma1    V K E I V K - P P Q F - - - - - - S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A -
Os029803_Os08t0    C K D I V Q - S P E I - - - - - - C G K L T F P V S L K Q P G P R D G L I Q C F I K R D K S K L T Y Y L Y L C L S P A -
gm003397_Glyma0    C K E I V T - S P E F - - - - - - C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A -
Os009468_Os02t0    T K E V V K - T L E E - - - - - - C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S -
pp000633_Pp1s10    T K E L V R - T P E Q - - - - - - S G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S -
pt001717_POPTR_    T K A V V K - T P E Q - - - - - - C G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y H L Y L G L S P A -
Sb028483_Sorbi1    C R E I V K - S P E V - - - - - - S G K I T F P V S L K Q P G P R D G T I Q C F I K R D K S T Q V Y S L Y L S F S S A -
gm044960_Glyma1    C K E I V T - S P E F - - - - - - C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A -
pt041132_POPTR_    T K E L V K - V P E L - - - - - - S G K L T F P I S V K Q P G P R D F L L Q C F I K R C R S A Q T Y R L Y L G L N N A -
gm054929_Glyma2    C K E I V S - S P E F - - - - - - C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L C L S P A -
Os004869_Os01t0    C K E T V L - S P E F - - - - - - C G K L T F P V S I K Q P G P R D G M I Q C Y I K R N R S K S T Y H L Y L C L S N V -
gm030081_Glyma1    T K E I V K - T P E Q - - - - - - C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S -
gm048089_Glyma1    T K D V V K - T P E Q - - - - - - C G F I T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A -
Os019649_Os04t0    C K D I V R - N P E F - - - - - - C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A -
Sb027814_Sorbi1    T K E V V K - T L E E - - - - - - C G R I T F P I S L K Q P G P R D L P V Q C F V R R E R A T S T Y L L Y L G L S P S -
pp034735_Pp1s15    T K E L V R - T P E Q - - - - - - S G R L T F P I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S -
gm039265_Glyma1    T K D V I K - T P E Q - - - - - - C G L L T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A -
pt034249_POPTR_    T K D L V K - V P E L - - - - - - S G K I T F P I S V K Q P G P R E Q L L Q C F I K R C R S T Q T Y R L Y L S L N N A -
Sb024300_Sorbi1    V K E M V R - V P E V - - - - - - S G K I T F P I S L K Q P G P R D A P M K C F I R R N R A T Q S Y S L C I G I T D A -
gm054928_Glyma2    C K E I V S - S P E F - - - - - - C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L C L S P A -
Sb032660_Sorbi1    C R E I V L - S P E F - - - - - - C G K L T F P V S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A -
gm021740_Glyma0    C K D I V K - S P E F - - - - - - C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A -
gm041730_Glyma1    T I D I V K - T P E L - - - - - - S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S S Q T Y Y L Y L S L T N T -
gm045746_Glyma1    V K E I V K - P P Q F - - - - - - S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A -
gm003396_Glyma0    C K E I V T - S P E F - - - - - - C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A -
gm044959_Glyma1    C K E I V T - S P E F - - - - - - C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A -
gm004126_Glyma0    M K E I V K - S P Q L - - - - - - S G K L T F P I S L K Q P G P R D S L L Q C Y I K R N R S N Q T Y Y L F L G L N Q A -
pt000710_POPTR_    C K E I V R - S P E F - - - - - - S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A -
pp034734_Pp1s15    T K E L V R - T P E Q - - - - - - S G R L T F P I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S -
pp022942_Pp1s22    T K E L V R - T P E Q - - - - - - S G R L T F P I A L K Q P G P R D S T M Q C F I K R D R T T S T Y Q L F L G L P P S -
gm021741_Glyma0    C K D I V K - S P E F - - - - - - C G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A -
gm036751_Glyma1    T K D I V K - T P E L - - - - - - S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S T Q T Y Y L F L S L T S T -
Sm016835_Selmo1    T K E I V Q - T L E Q - - - - - - C G R L T F P V S L K Q P G P R D A T V Q C Y L K R D R T T S T Y Y L Y L G I T P S -
gm028526_Glyma1    C K E I V S - S P E F - - - - - - C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L G L S P A -
pp022947_Pp1s22    T K E L V R - T P E Q - - - - - - S G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S -
pt000711_POPTR_    C K E I V R - S P E F - - - - - - S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A -
pt037558_POPTR_    T K E I V K - T P E Q - - - - - - C G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S -
gm037352_Glyma1    T R E V V R - V P S H - - - - - - T G K I T F P A C L K Q P G P R D V P H Q C L I K R N K K T S T F Y L Y L A L T P S F
gm019438_Glyma0    V K E I V K - P P Q L - - - - - - S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A T Q T Y Y L F L S L S S A -
pt039357_POPTR_    C K E I V R - S P E F - - - - - - S G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A -
pt037730_POPTR_    T K T V V K - T P E Q - - - - - - C G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y L L Y L G L S P A -
gm030080_Glyma1    T K E I V K - T P E Q - - - - - - C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S -
Os019651_Os04t0    C K D I V R - N P E F - - - - - - C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A -
pt028965_POPTR_    T K D I V K S L P N N N N N N G S S G K I T F P S C L K Q P G P R D L P H Q C L I K R N K K T S T F Y L Y L A L T P S F
pt000709_POPTR_    C K E I V R - S P E F - - - - - - S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A -
pt037559_POPTR_    T K E I V K - T P E Q - - - - - - C G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S -
gm003395_Glyma0    C K E I V T - S P E F - - - - - - C G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A -
gm045745_Glyma1    V K E I V K - P P Q F - - - - - - S S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A -
gm028527_Glyma1    C K E I V S - S P E F - - - - - - C G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L G L S P A -
Os009471_Os02t0    T K E V V K - T L E E - - - - - - C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S -
pt002868_POPTR_    C K E I V R - N P E F - - - - - - S G K I T F P V S L K Q P G P R D G T I Q C F I K R D K S K L T Y H L F L C L S P A -
gm039266_Glyma1    T K D V I K - T P E Q - - - - - - C G L L T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A -
pp005711_Pp1s21    T K E L V R - A P E Q - - - - - - S G R L T F P V A L K Q P G P R E D T V Q C F I K R D R T T S T Y Q L F L G L P P S -
gm003133_Glyma0    T R E I V K - T P E Q - - - - - - C G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y F G L V P S -
gm034540_Glyma1    T R E V V R - V P S H - - - - - - T G K I T F P S C L K Q P G P R D V P H Q C L I K R N Q K T S T F Y L Y L A L T P S F
gm044675_Glyma1    T R E I V K - T P E Q - - - - - - C G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y F G L V P S -
Sm008088_Selmo1    T K E L V K - S P E L - - - - - - S G K L T F P V S L K Q P G P R D A T V Q C Y I E R D R T T A T Y R L F L G L T P T -
gm001764_Glyma0    T K E I V K - T P E Q - - - - - - C G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S -
pt001281_POPTR_    T K E I V K - T P E Q - - - - - - C G R L T F P I S L K Q P G P R E S P I Q C F I K R D N A T S T F L L Y Y G L V P S -
Os029491_Os07t0    V R E I V R - T P E A - - - - - - S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A -
Os040209_Os12t0    C R E I V K - N P E F - - - - - - C G K I T F P V S L K Q P G P R N G A I Q C F I K R D K S T Q T Y N L Y L C L S S A -
 
AT2G18280.1     - - - - E T E N D K L L L A A R R I R R A T C T D F I I S L S A K N F S R S S S - - T Y V G K L - - - - - - - - - - - -
gm021742_Glyma0    - - - L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N - - T Y I G K L - - - - - - - - - - - -
Sm012016_Selmo1    D A G L - Q E H G K F L L A A R K V R R A T T T D Y I I S L D P E D F S R G S T - - S Y V G K L - - - - - - - - - - - -
gm021743_Glyma0    - - - L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N - - T Y I G K L - - - - - - - - - - - -
Os021774_Os05t0    - - - V L A D S G K F L L S A K R H R K T T C T E Y V I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
pt000712_POPTR_    - - - L L V E N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S - - T Y I G K L - - - - - - - - - - - -
gm041219_Glyma1    - - - L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N - - T Y I G K L - - - - - - - - - - - -
Os021773_Os05t0    - - - V L A D S G K F L L S A K R H R K T T C T E Y V I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
Os029490_Os07t0    - - - L - T D D G K F L L A A R K C R R T T C T E Y L I S L D M N D I S K R T D - - S Y V G K L - - - - - - - - - - - -
pp034759_Pp1s15    - - - L - V E N G K F L L A A K K F R R P T R T D Y I I S L N H D D M S R G G T - - A Y V G K L - - - - - - - - - - - -
gm045744_Glyma1    - - - L V A D D G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S N - - A Y V G K L R S T L N Q I L L L A I
Os029803_Os08t0    - - - V L S E N G K F L L A A K R N R R A T S T E Y I I S V D S K N I S R S S N - - G Y V G K M - - - - - - - - - - - -
gm003397_Glyma0    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S - - T Y I G K L - - - - - - - - - - - -
Os009468_Os02t0    - - - L H G E N D K L L L A A R K I R R A T R T S F V I S L V S N D F S L S S S - - T Y V G K L - - - - - - - - - - - -
pp000633_Pp1s10    - - - L - I E N G K F L L A A R K F R R A T S T D Y I I S L N Q E D M S R G S N - - T Y V G K L - - - - - - - - - - - -
pt001717_POPTR_    - - - L S G D M S K L L L A A K K I R K A T S T D F R I S F V G S D F C Q T S N - - T Y A G K L - - - - - - - - - - - -
Sb028483_Sorbi1    - - - V P A E D G K F L L S A K R N C R P T Y T E Y T I S I N S G D I S R S T S N N T Y I G K L - - - - - - - - - - - -
gm044960_Glyma1    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S - - T Y I G K L - - - - - - - - - - - -
pt041132_POPTR_    - - - L - T E D G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N - - A Y V G K L - - - - - - - - - - - -
gm054929_Glyma2    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
Os004869_Os01t0    - - - V T A E G G K F V L A A K R H R K T T C T E Y T I S M V S G N I S R S S R - - T N I G K L - - - - - - - - - - - -
gm030081_Glyma1    - - - - E N E T D K L L L A A K K V R R A T G T D F I I S L V A D D F S R S S N - - T Y V G K L - - - - - - - - - - - -
gm048089_Glyma1    - - - L S G D M S K L L L A A K K I R R A T C T E F I I S L V S D D F S W A S N - - T Y V G K L - - - - - - - - - - - -
Os019649_Os04t0    - - - V L D E T G K F L L S A K R S R R T T H T D Y I I S M D S K N I S R S S S - - G Y I G K L - - - - - - - - - - - -
Sb027814_Sorbi1    - - - M N M E N D K L L L A A R K V R R A T R T S F V I S L V S D D F S H S S S - - T Y V G K L - - - - - - - - - - - -
pp034735_Pp1s15    - - - L - V E N G K F L L A A R K F R R A A S T D Y I I S L N Q E D I S R G S N - - T Y V G K L - - - - - - - - - - - -
gm039265_Glyma1    - - - L S G D M S K L L L A A K K I R R A T C T E F I I S L V A D D F S R A C D - - T Y V G K L - - - - - - - - - - - -
pt034249_POPTR_    - - - L - T E D G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N - - T Y A G K L - - - - - - - - - - - -
Sb024300_Sorbi1    - - - L - A D D G K F L L A A R R S R R P A G T E Y L I S L D A K N T S K G - - - - T C I G K L - - - - - - - - - - - -
gm054928_Glyma2    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
Sb032660_Sorbi1    - - - V L M E N G K F L L S A K R N R K T T C T E Y V I S M D A E N I S R S S S - - T Y I G K L - - - - - - - - - - - -
gm021740_Glyma0    - - - L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N - - T Y I G K L - - - - - - - - - - - -
gm041730_Glyma1    - - - L - A E D G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S N - - S Y V G K L - - - - - - - - - - - -
gm045746_Glyma1    - - - L V A D D G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S N - - A Y V G K L - - - - - - - - - - - -
gm003396_Glyma0    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S - - T Y I G K L - - - - - - - - - - - -
gm044959_Glyma1    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S - - T Y I G K L - - - - - - - - - - - -
gm004126_Glyma0    - - - S - T D E G K F L L S A R K C R R A T H T D Y I I S L N C D D V S R G S S - - T Y I G K L - - - - - - - - - - - -
pt000710_POPTR_    - - - L L V E N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S - - T Y I G K L - - - - - - - - - - - -
pp034734_Pp1s15    - - - L - V E N G K F L L A A R K F R R A A S T D Y I I S L N Q E D I S R G S N - - T Y V G K L - - - - - - - - - - - -
pp022942_Pp1s22    - - - L - V E N G K F L L A A R K C R R A T S T D Y I V S L N H E D M S R G S N - - T Y V G K L - - - - - - - - - - - -
gm021741_Glyma0    - - - L L V E N G K F L L S A K R T R R T T Y T E Y V I S M D A D N I S R S S N - - T Y I G K L - - - - - - - - - - - -
gm036751_Glyma1    - - - L - A E D G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S N - - S Y V G K L - - - - - - - - - - - -
Sm016835_Selmo1    - K P S - K K N G K F L L A A R K F R R A S G T D Y I I S T D T D D F S R G S N - - T Y V G K L - - - - - - - - - - - -
gm028526_Glyma1    - - - L L V E N G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
pp022947_Pp1s22    - - - L - V E N G K F L L A A R K F R R A T S T D Y I I S L N Q E N M S R G S N - - T Y V G K L - - - - - - - - - - - -
pt000711_POPTR_    - - - L L V E N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S - - T Y I G K L - - - - - - - - - - - -
pt037558_POPTR_    - - - - E G E N D K L L L A A R K I R R A T C S D F I V S L V S D D F S R A S N - - T Y V G K L - - - - - - - - - - - -
gm037352_Glyma1    - - - - - T D K G K F L L A A R R Y R C G T H T E Y I I S L D A D D L S Q G S N - - A Y V G K L - - - - - - - - - - - -
gm019438_Glyma0    - - - L I A D D G K F L L A A R K F R R P T C I D Y I I S L D A D D M S R E S N - - A Y V G K L - - - - - - - - - - - -
pt039357_POPTR_    - - - L L V E N G K F L L S A K R K R R T A C T E Y V I S M D A D N V S R S S S - - T Y I G K L - - - - - - - - - - - -
pt037730_POPTR_    - - - L S G D M N K V L L A A K K I R K A T S T D F R I S F A G S D F C Q T S N - - T Y V G K L - - - - - - - - - - - -
gm030080_Glyma1    - - - - E N E T D K L L L A A K K V R R A T G T D F I I S L V A D D F S R S S N - - T Y V G K L - - - - - - - - - - - -
Os019651_Os04t0    - - - V L D E T G K F L L S A K R S R R T T H T D Y I I S M D S K N I S R S S S - - G Y I G K L - - - - - - - - - - - -
pt028965_POPTR_    - - - - - T D K G K F L L A A R R Y R Q G V H T E Y I I S L D A D D L S Q G S N - - A Y V G K L - - - - - - - - - - - -
pt000709_POPTR_    - - - L L V E N G K F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S - - T Y I G K L - - - - - - - - - - - -
pt037559_POPTR_    - - - - E G E N D K L L L A A R K I R R A T C S D F I V S L V S D D F S R A S N - - T Y V G K L - - - - - - - - - - - -
gm003395_Glyma0    - - - L L V E N G K F L L S A K R T R R T T C T E Y I I S M D A D N I S R S N S - - T Y I G K L - - - - - - - - - - - -
gm045745_Glyma1    - - - L V A D D G K F L L A A R K F R R P T C T D Y I I S L D A D D M S R E S N - - A Y V G K L - - - - - - - - - - - -
gm028527_Glyma1    - - - L L V E N G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
Os009471_Os02t0    - - - L H G E N D K L L L A A R K I R R A T R T S F V I S L V S N D F S L S S S - - T Y V G K L - - - - - - - - - - - -
pt002868_POPTR_    - - - L L V E N G K F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S S - - T Y I G K L - - - - - - - - - - - -
gm039266_Glyma1    - - - L S G D M S K L L L A A K K I R R A T C T E F I I S L V A D D F S R A C D - - T Y V G K L - - - - - - - - - - - -
pp005711_Pp1s21    - - - Q - - E N G K F L L A A Q K F R R A T S T D Y I I S L N Q E D M S R G S S - - T Y V G K L - - - - - - - - - - - -
gm003133_Glyma0    - - - - E N D S N K L L L A A K R I R R A T G T G F V I S L A A D D F S R A S N - - K Y V G K L - - - - - - - - - - - -
gm034540_Glyma1    - - - - - T D K G K F L L A A R R Y R C G T H T E Y I I S L D A D D L S Q G S N - - A Y V G K L - - - - - - - - - - - -
gm044675_Glyma1    - - - - E N D G N K L L L A A K R I R R A T G T D F I I S L A A D D F S R A S N - - K Y V G K L - - - - - - - - - - - -
Sm008088_Selmo1    - - - L - T E N G K F L L A A R K S R R A T S T D Y I I S I D P E D M S R G S S - - S C V G K L - - - - - - - - - - - -
gm001764_Glyma0    - - - - E N E T D K L L L A A K K V R R A T G T D F V I S L V A D D F F R S S N - - T Y V G K L - - - - - - - - - - - -
pt001281_POPTR_    - - - - G G E N D K L L L A A R K I R R A T C T D F I V S L V S D D F S R A S N - - T Y V G K L - - - - - - - - - - - -
Os029491_Os07t0    - - - L - T D D G K F L L A A R K C R R T T C T E Y L I S L D M N D I S K R T D - - S Y V G K L - - - - - - - - - - - -
Os040209_Os12t0    - - - V L V E S G K F L L S A K R Y S R A T C T E Y T I F M S A D N T S R S S N - - M Y I G K L - - - - - - - - - - - -
 
AT2G18280.1     - - - - - - - - - - - - - - - - - - R S G F L G T K F T I Y D N Q T A S S T A - - - - - Q - A Q P N R R - L H P K Q - A
gm021742_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F Y S K K - V
Sm012016_Selmo1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H V G A M P S N - - - S R V G R R - F G S K Q - I
gm021743_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F Y S K K - V
Os021774_Os05t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R S S R R - F N S K K - V
pt000712_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R R - F Y S K K - V
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y S S A H I C P P G T G K T S R R - F Y S K K - V
Os021773_Os05t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R S S R R - F N S K K - V
Os029490_Os07t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D A H P P Y A G D V I S K - - - G Q S A R V - I G S N H - L
pp034759_Pp1s15    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S - - - - N R G A W R - M G T K Q - L
gm045744_Glyma1    L L F L F L S A K T N P L S S H F I R S N F L G T K F T I Y D - - - - - - - - - - R K - - - S C S T E L V V N S K Q - V
Os029803_Os08t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F V V Y D T Q P P Y N A G S L M S C Q - - H G S R R - I S S R R - V
gm003397_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F Y S K K - V
Os009468_Os02t0    - - - - - - - - - - - - - - - - - - K P N F L G T K F T I F D S Q P P C D A V V L P - - N - N R P S K R - - H F K Q - V
pp000633_Pp1s10    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H N R G V A S - - - - N R S S R R - I G S K Q - L
pt001717_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P C P G L K S - - - N - C K L Q Q K - V R S I Q - V
Sb028483_Sorbi1    - - - - - - - - - - - - - - - - - - R S N F L G T K F V I Y D T Q P P Y N A T S P T V A G - - K T N Q R - F Y S K K G G
gm044960_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F Y S K K - V
pt041132_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T V F D G Q P P H A G A K M T K - - - S R S S R L - V N L K Q - V
gm054929_Glyma2    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R R - F - S K K - V
Os004869_Os01t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N G A V V P H V G - - R T S K R - F N S T K - V
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P - - D - S Q P S R R - F H S K Q - V
gm048089_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I L D G E P A H E T S L P L - - N - C K L Q Q R - V H L K Q - V
Os019649_Os04t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E - - R T S R R - F S S R K - V
Sb027814_Sorbi1    - - - - - - - - - - - - - - - - - - K P N F L G T K F T I F D S Q P P P D A V V L P - - N - N K P S K R - - Q S K Q - V
pp034735_Pp1s15    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S - - - - N R G A W R - M G T K Q - L
gm039265_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I L D G E P P H D S S L P L - - N - C K L Q Q R - V H L K Q - V
pt034249_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T V F D G Q P P H A G A K M T K - - - S Y S S R L - V N L K Q - V
Sb024300_Sorbi1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T V Y D A H P P C T G A V V S K - - - G P S A H M - I G S A Q - V
gm054928_Glyma2    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - R S R R - F - S K K - V
Sb032660_Sorbi1    - - - - - - - - - - - - - - - - - - R S N F L G T K F M I S D T Q P P Y N G A V V P H A G - - R T S R R - F N S K K - V
gm021740_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F Y S K K - V
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D G Q P P H A G A K I M K - - - S R S T R L - V N L K Q - V
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K - - - S C S T E L V V N S K Q - V
gm003396_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F Y S K K - V
gm044959_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F Y S K K - V
gm004126_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F T V Y D A H P P I Y G A K V T K - - - S R S T R L - V S L K Q - V
pt000710_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R R - F Y S K K - V
pp034734_Pp1s15    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S - - - - N R G A W R - M G T K Q - L
pp022942_Pp1s22    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H S G V V A S - - - - N R G T R R - L G S K Q - L
gm021741_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K T S R R - F Y S K K - V
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K - - - S R S T R L - V N L K Q - V
Sm016835_Selmo1    - - - - - - - - - - - - - - - - - - R S N F M G T K F T L Y D S N P P H D G A V A S T - - - N R A G R R - I L S K Q - V
gm028526_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R R - F - S K K - V
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H S G V V A S - - - - N R G T R R - M G S K Q - L
pt000711_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R R - F Y S K K - V
pt037558_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A - N R I S R R - F H S R Q - V
gm037352_Glyma1    - - - - - - - - - - - - - - - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S - - - G R A S R R - F A S K Q - I
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D I P L P H V G A K M T K - - - S C F T K L - V N P K Q - V
pt039357_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R R - F Y S K K - V
pt037730_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D G Q T P C P A M R S - - - N - C K P Q R K - V R S I Q - V
gm030080_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P - - D - S Q P S R R - F H S K Q - V
Os019651_Os04t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E - - R T S R R - F S S R K - V
pt028965_POPTR_    - - - - - - - - - - - - - - - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S - - - S R A S R R - F A S K Q - I
pt000709_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - R S R R - F Y S K K - V
pt037559_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A - N R I S R R - F H S R Q - V
gm003395_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F Y S K K - V
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K - - - S C S T E L V V N S K Q - V
gm028527_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - R S R R - F - S K K - V
Os009471_Os02t0    - - - - - - - - - - - - - - - - - - K P N F L G T K F T I F D S Q P P C D A V V L P - - N - N R P S K R - - H F K Q - V
pt002868_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - R S R R - F Y S K K - V
gm039266_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I L D G E P P H D S S L P L - - N - C K L Q Q R - V H L K Q - V
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P Q N G P V L S - - - - N R S S R R - L T S K Q - L
gm003133_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F T V Y D S Q A P H D S A I Q S - - N - C Q S S R R - F H S K Q - V
gm034540_Glyma1    - - - - - - - - - - - - - - - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S - - - G R A S R R - F A S K Q - I
gm044675_Glyma1    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I F D S Q A P N D V A I Q P - - N - C Q S S R R - F H S K Q - V
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - R S N F L G T K F A I Y D T Q P P H S G A I A S T - - - N R A G R R - V A A K Q - V
gm001764_Glyma0    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D S Q P P Q G A A I Q P - - D - N R S S R R - F H S K Q - V
pt001281_POPTR_    - - - - - - - - - - - - - - - - - - R S N F L G T K F T M Y D S E P T F E V P R Q L - - A - S R T S R R - F N P R Q - V
Os029491_Os07t0    - - - - - - - - - - - - - - - - - - R S N F L G T K F T I Y D A H P P Y A G D V I S K - - - G Q S A R V - I G S N H - L
Os040209_Os12t0    - - - - - - - - - - - - - - - - - - R S N L L G T K F V I Y D T Q P P C N T A N V S Q S G - - K T S R R - F Y S R K - V
 
AT2G18280.1     A - - P - K L - P T N S S T V G N I T Y E L N V L R T R G P - - - - - - R R M H C A M D S I P L S S V - - - - - - - - -
gm021742_Glyma0    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A - - - G G T -
Sm012016_Selmo1    S - - P - R V - P S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q V T I H S I P A S A M D P - - - G G V -
gm021743_Glyma0    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A - - - G G T -
Os021774_Os05t0    S - - P - K M - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M H C V M H S I P A S S V E P - - - G G I -
pt000712_POPTR_    S - - P - K V - P T G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P V S S L E P - - - G G S -
gm041219_Glyma1    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A - - - G G T -
Os021773_Os05t0    S - - P - K M - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M H C V M H S I P A S S V E P - - - G G I -
Os029490_Os07t0    S - - P - R I - P A G N Y P V S H I S Y E L N V L G S R G P - - - - - - R R M H C A M D S I P V S A I E Q - - - G G T -
pp034759_Pp1s15    S - - S - R V - H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A M E S - - - G G S -
gm045744_Glyma1    S P R P - R V - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P - - - G G V A
Os029803_Os08t0    S - - P - K L - P T G S Y P I A H V K Y E L N V L G T R G P - - - - - - R R M Q C T M H S I P A S A V D P - - - E G V -
gm003397_Glyma0    S - - P - K V - P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P - - - G C T -
Os009468_Os02t0    S - - P - R L - P L G N Y N V A T V S Y E L T V L R N R G P - - - - - - R R M Q C T M H S I P A L C I Q E - - - G G K -
pp000633_Pp1s10    T - - S - R V - H A G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C M L H T I P M S A M E S - - - G G S -
pt001717_POPTR_    S - - P - G V - P A R N F N V A T V S Y E L N V L R T R G P - - - - - - R R M H C I V H S I P I S A I Q E - - - G G V -
Sb028483_Sorbi1    S - - T - K G - S C S R Y S I G Q V S Y E L N V L G T R G P - - - - - - R R M N C V M H S I P A S C L E A - - - G G S -
gm044960_Glyma1    S - - P - K V - P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P - - - G C T -
pt041132_POPTR_    S - - P - R V - P T G N Y P V A S I S Y E L N V L G S R G P - - - - - - R R M H C I M D A I P A S A I E P - - - G G I -
gm054929_Glyma2    S - - P - K V - P S G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P - - - N G I -
Os004869_Os01t0    S - - P - K V - P S V T Y N I A Q V S Y E L N V L G T R G P - - - - - - R R M R C M M H S I P A S S V E P - - - G G I -
gm030081_Glyma1    S - - P - R V - P A C N Y V V S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I P V S A V Q A - - - G G N -
gm048089_Glyma1    L - - P N K V A A A A N Y K V A T R S K A N A V Y D A L N P H I C N P R R R E R - - - - - - - - - - - - - - - - - - - -
Os019649_Os04t0    S - - P - K V - P T G C Y P I V Q V N Y E L N V L G T R G P - - - - - - R R M Q C A M H S I P A S A V E P - - - G G I -
Sb027814_Sorbi1    S - - P - R L - P L G N Y N V A T V T Y E L T V L R N R G P - - - - - - R R M Q C T M H S I P A E C I Q E - - - G G K -
pp034735_Pp1s15    S - - S - R V - H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A M E S - - - G G S -
gm039265_Glyma1    L - - P N K V - S A A N Y K V A T V S Y E L N V L R T R G P - - - - - - R R M R C M M H L I P I S A I Q E - - - G G N -
pt034249_POPTR_    S - - P - R V - P T G N Y P V A N I S Y E L N V L G S R G P - - - - - - R R M H C I M D A I P A A A I E P - - - G G V -
Sb024300_Sorbi1    S - - P - G V - P A G N Y P I S H I S Y E A T - F G S R Y P - - - - - - R K M N C V M D S I P L S A I K E - - - G G T -
gm054928_Glyma2    S - - P - K V - P S G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P - - - N G I -
Sb032660_Sorbi1    S - - P - K V - P T G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M H C V M H S I P A S A V E P - - - G G I -
gm021740_Glyma0    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A - - - G G T -
gm041730_Glyma1    S - - P - K V - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A A A I E P - - - G G V -
gm045746_Glyma1    S P R P - R V - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P - - - G G V A
gm003396_Glyma0    S - - P - K V - P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P - - - G C T -
gm044959_Glyma1    S - - P - K V - P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P - - - G C T -
gm004126_Glyma0    S - - P - R V - P A G N Y P I A H V S Y D L N V L G S R G P - - - - - - R I M Q C V M D A I P A S A V E P - - - G G V -
pt000710_POPTR_    S - - P - K V - P T G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P V S S L E P - - - G G S -
pp034734_Pp1s15    S - - S - R V - H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A M E S - - - G G S -
pp022942_Pp1s22    T - - S - R V - H C G S H N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T M H S I P A S A M A S - - - G G S -
gm021741_Glyma0    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A - - - G G T -
gm036751_Glyma1    S - - P - K V - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A T A I E P - - - G G V -
Sm016835_Selmo1    S - - P - R V - P A G S Y N I A H I A Y E L N V L G T R G P - - - - - - R R M E C T I H S I P A S A M E P - - - G G C -
gm028526_Glyma1    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P - - - N G V -
pp022947_Pp1s22    T - - S - R V - H C G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T M H S I P A S A M A S - - - G G S -
pt000711_POPTR_    S - - P - K V - P T G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P V S S L E P - - - G G S -
pt037558_POPTR_    S - - P - R L - P A C N Y S I G T I T Y E L N V L R S R G P - - - - - - R R M H C M M H S I P M S S I E E - - - G G T -
gm037352_Glyma1    S - - P - Q V - P A G N F E V G Q V S Y K F N L L K S R G P - - - - - - R R M V C S L K C - P V T P V - - - - - - - - -
gm019438_Glyma0    S - - P - R V - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P - - - G G V A
pt039357_POPTR_    S - - P - K V - P T G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P A L S L E P - - - G G S -
pt037730_POPTR_    S - - P - G V - A A R N Y N V A T V S Y E L N V L R T R G P - - - - - - R R M H C T I H S I P I S A I Q E - - - G G I -
gm030080_Glyma1    S - - P - R V - P A C N Y V V S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I P V S A V Q A - - - G G N -
Os019651_Os04t0    S - - P - K V - P T G C Y P I V Q V N Y E L N V L G T R G P - - - - - - R R M Q C A M H S I P A S A V E P - - - G G I -
pt028965_POPTR_    S - - P - Q V - P A G N F E V G Q V S Y K F N L L K S R G P - - - - - - R R M V C S L K C - P V S Q - - - - - - - - - -
pt000709_POPTR_    S - - P - K V - P T G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P V S S L E P - - - G G S -
pt037559_POPTR_    S - - P - R L - P A C N Y S I G T I T Y E L N V L R S R G P - - - - - - R R M H C M M H S I P M S S I E E - - - G G T -
gm003395_Glyma0    S - - P - K V - P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P - - - G C T -
gm045745_Glyma1    S P R P - R V - P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P - - - G G V A
gm028527_Glyma1    S - - P - K V - P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P - - - N G V -
Os009471_Os02t0    S - - P - R L - P L G N Y N V A T V S Y E L T V L R N R G P - - - - - - R R M Q C T M H S I P A L C I Q E - - - G G K -
pt002868_POPTR_    S - - P - K V - P T G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P A S S L E P - - - G G S -
gm039266_Glyma1    L - - P N K V - S A A N Y K V A T V S Y E L N V L R T R G P - - - - - - R R M R C M M H L I P I S A I Q E - - - G G N -
pp005711_Pp1s21    S - - Y - R A - H A G S F N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H G I P L S T M E S - - - V G S -
gm003133_Glyma0    S - - P - R V - P A C S Y L V S T V S Y E L N V L C T R G P - - - - - - R R M H C V M N S I P V S A I Q E - - - G G N -
gm034540_Glyma1    S - - P - Q V - P A G N F E V G Q V S Y K F N L L K S R G P - - - - - - R R M V C S L K C - P V T P - - - - - - - - - -
gm044675_Glyma1    S - - P - R L - P A C N Y L V S T V S Y E L N V L C T R G P - - - - - - R R M Y C V M N S I P V S A I Q E - - - G G N -
Sm008088_Selmo1    S - - P - K V - P A G S Y N V A H I S Y E L N V L G T R G P - - - - - - R R M Q C T L H A V G A V S M D S D S E G M A -
gm001764_Glyma0    S - - P - R V - P A C N Y V V S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I S V S A V Q E - - - G G N -
pt001281_POPTR_    S - - L - R L - P A C N Y C I A T I T Y E L N V L R S R G P - - - - - - R R M H C I M H S I P M S S I E E - - - G G T -
Os029491_Os07t0    S - - P - R I - P A G N Y P V S H I S Y E L N V L G S R G P - - - - - - R R M H C A M D S I P V S A I E Q - - - G G T -
Os040209_Os12t0    S - - P - K N - P S S T Y S I A Q V S Y E L N V L G T R G P - - - - - - R R M N C V M H S I P A S S L E A - - - G G T -
 
AT2G18280.1     - - - I A E P S - - V V Q G I - E E E V S S - - - - - - - - - - - - - - - S P S P K G E T I - - - - T T D K E I P D N S
gm021742_Glyma0    - - V P G Q P E - L L P R P L - E D S F R S - - I S F S K S - - - - - - - - - - - L D R S I - - - - - - E F - - - - S S
Sm012016_Selmo1    - - A P T P T V - - F - A N P - L E D - A Q - - L P F - - - - - - - - - - - - - P V S K S K - - - - - - V S - - - - D C
gm021743_Glyma0    - - V P G Q P E - L L P R P L - E D S F R S - - I S F S K S - - - - - - - - - - - L D R S I - - - - - - E F - - - - S S
Os021774_Os05t0    - - V P G Q P E Q I V P R A F - E E S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F - - - - S S
pt000712_POPTR_    - - V P G Q P E - L L P C S L - E D S F R S - - I S F S K S - - - - - - - - - - - I D N S T - - - - - - E F - - - - S S
gm041219_Glyma1    - - V P G Q P E - L L P R S L - E D S F R S - - I S F S K S - - - - - - - - - - - L D H S I - - - - - - E F - - - - S S
Os021773_Os05t0    - - V P G Q P E Q I V P R A F - E E S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F - - - - S S
Os029490_Os07t0    - - A P T Q T E - - F P L S Y - H E S F T S - - I P F - - - - - - - - - - - - - F K S K S V - - - - - - - - - - - - - -
pp034759_Pp1s15    - - A P T P T E - - L A A G S - L E E - V H - - V P Y S S I - - - - - - - M S S P R S K A A - - - - - - V V - - - - D S
gm045744_Glyma1    V A A P S Q T D - - F S V S N - R D - - T S - - F P F - - - - - - - - - - - - - F Q T N S T - - - - - - - - - - - - - -
Os029803_Os08t0    - - V P G Q P E Q L L P G P F - E E S F R S T N T S - S R F - - - - - - - - - S F M D R S L - - - - - - D F - - - - S S
gm003397_Glyma0    - - V P G Q P E - L L P R S L - E D S F R S - - I S F A R S - - - - - - - - - - - I D N S T - - - - - - E F - - - - S S
Os009468_Os02t0    - - A P T P T G - - I I H S L - D E Q V P A - - - - - - - - - - - - - - - L S T S K G K E P - - - - A I E F - - - - S S
pp000633_Pp1s10    - - A P T P T E - - F T A S T - L E D - T H - - V A Y S G I - - - - - - - L S S P R S R A A - - - - - - V V - - - - D S
pt001717_POPTR_    - - A P T P L E - - F N N P G - D E Q S P S - - - - - - - - - - - - - - - L S A S K V K Q P - - - - L I D F - - - - I S
Sb028483_Sorbi1    - - V P C Q P D S I V A H S V - G E M F S S - - I P L S K S - - - - - - - - - S T M D H S M - - - - - - H F - - - - S S
gm044960_Glyma1    - - V P G Q P E - L L P R S L - E D S F R S - - I S F A R S