fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT2G18280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Pt037558 not found in 416aa AT2G18280.2 not_not 0.620689655 III
Pt001281 not found in 414aa AT2G18280.2 not_not 0.602122015 III
Pt037730 not found in 416aa AT1G47270.1 not_not 0.539787798 III
Pt000712 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt000711 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt000710 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt000709 not found in 424aa AT1G76900.2 not_not 0.529177718 III
Pt002868 not found in 423aa AT1G25280.1 not_not 0.523872679 III
Pt001717 not found in 416aa AT1G47270.1 not_not 0.522546419 III
Pt039357 not found in 424aa AT1G76900.2 not_not 0.511936339 III
Pt041132 not found in 392aa AT2G47900.2 not_not 0.486737400 III
Pt034249 not found in 395aa AT2G47900.2 not_not 0.478779840 III
Pt028965 not found in 377aa AT1G53320.1 not_not 0.404509283 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT2G18280.1     -MSLKSILRDLKEVRDGL------GGISKRS--------W--SKSSHIAPD-----QTT-
pt034249_POPTR_ MPALKSIIN---------------------------------RSTSHRVVQYSSAPELNL
pt039357_POPTR_ -MSFRSIVRD---MRDGF------GSLSRRSFEVRLPGHL--RGKSH-----GSACELQ-
pt000711_POPTR_ -MSFRSIVRD---MRDGF------GSLSRRSFEVRLPGHF--RGKSH-----GSACELL-
pt041132_POPTR_ MSAIKSIIN---------------------------------RSRSHRVVQYSSAPDLSL
pt037558_POPTR_ -MSIKSIVRELKEMKDGI------GNISRRGLEGK---HWRGRARSHIAPD-----ETP-
pt000710_POPTR_ -MSFRSIVRD---MRDGF------GSLSRRSFEVRLPGHF--RGKSH-----GSACELL-
pt002868_POPTR_ -MSFRSIVRD---MRDGF------GSLSRRSFEVRLPGHH--RGKSH-----SSACELH-
pt000709_POPTR_ -MSFRSIVRD---MRDGF------GSLSRRSFEVRLPGHF--RGKSH-----GSACELL-
pt001717_POPTR_ -MSFKS---KLKEIRDDITTTFSMGKLQRNRTNR--------RGRAYIAPELGGGSELL-
pt001281_POPTR_ -MSFKSIMREFKEIKEGI------GSISRRGVEGK---HWCGRVRSHIAPD-----ETR-
pt037730_POPTR_ -MSFKG---KLKEIRDDISTTFSMGKLQRNRTNR--------RGRAYIAPELGGGSELF-
pt028965_POPTR_ -MSLRR------------------SFLSRRFS----------RSFNNQNRNERNGVESGR
pt000712_POPTR_ -MSFRSIVRD---MRDGF------GSLSRRSFEVRLPGHF--RGKSH-----GSACELL-
                  :::                                                   :   

AT2G18280.1     --PPLDNIPQSPWASLPPELLHDIIWRVEESETAWPARAAVVSCASVCKSWRGITMEIVR
pt034249_POPTR_ FAAGGAAETASCWANLPQELLREVLVRIEESESSWPPRKNVVACAGVCRSWRHITKDLVK
pt039357_POPTR_ --DQPVVIQNSRWAGLPPELLQDVIKRLEASESTWPSRKHVVACASVCRAWREMCKEIVR
pt000711_POPTR_ --DQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIVR
pt041132_POPTR_ FGGGCGAETTSCWANLPQELLREVLIRIEESESSWPPRKNVVACAGVCRSWRDITKELVK
pt037558_POPTR_ --AETDQIEQGQWANLPPELLLDIIRRVEESETSWPARAVVVHCASVCRSWREITKEIVK
pt000710_POPTR_ --DQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIVR
pt002868_POPTR_ --DQPVVIQNSRWAGLPPELLRDVIKRLEASESTWPARKHVVACAAVCSAWREMCKEIVR
pt000709_POPTR_ --DQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIVR
pt001717_POPTR_ --SELIE-EQSPWANLPPELLQDVIKRVEGSETSWPGRRDVVACASVCTSWREITKAVVK
pt001281_POPTR_ --EETDQIDQGQWANLPPELLLDIIMRLEESESSWPARVVVVHCASVCRSWREITKEIVK
pt037730_POPTR_ --RELIE-EQSPWANLPPELLHDVIQRVEGSETSWPGRRDVVACASVCKSWREITKTVVK
pt028965_POPTR_ LVGESGG-ESDGWGSMLPELLGEIIKRVEESEDRWPQRQNVVACACVCKKWREVTKDIVK
pt000712_POPTR_ --DQPVVIQDSPWAGLPPELLRDVIKRLEASESTWPARKHVVACASVCRAWREMCKEIVR
                          . *..:  *** ::: *:* **  ** *  ** ** **  ** :   :*:

AT2G18280.1     I-PE------QCGKLTFPISLKQPGPRDSPIQCFIKRNRATATYILYYGLMPS-ETENDK
pt034249_POPTR_ V-PE------LSGKITFPISVKQPGPREQLLQCFIKRCRSTQTYRLYLSLNNA-LTEDGK
pt039357_POPTR_ S-PE------FSGKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGK
pt000711_POPTR_ S-PE------FSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVENGK
pt041132_POPTR_ V-PE------LSGKLTFPISVKQPGPRDFLLQCFIKRCRSAQTYRLYLGLNNA-LTEDGK
pt037558_POPTR_ T-PE------QCGRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-EGENDK
pt000710_POPTR_ S-PE------FSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVENGK
pt002868_POPTR_ N-PE------FSGKITFPVSLKQPGPRDGTIQCFIKRDKSKLTYHLFLCLSPALLVENGK
pt000709_POPTR_ S-PE------FSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVENGK
pt001717_POPTR_ T-PE------QCGCITFPISLKQPGPRDAPIQCFIKRERATSTYHLYLGLSPALSGDMSK
pt001281_POPTR_ T-PE------QCGRLTFPISLKQPGPRESPIQCFIKRDNATSTFLLYYGLVPS-GGENDK
pt037730_POPTR_ T-PE------QCGCITFPISLKQPGPRDAPIQCFIKRERATSTYLLYLGLSPALSGDMNK
pt028965_POPTR_ SLPNNNNNNGSSGKITFPSCLKQPGPRDLPHQCLIKRNKKTSTFYLYLALTPS-FTDKGK
pt000712_POPTR_ S-PE------FSGKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPALLVENGK
                  *:       .* :*** .:**** *:   **:***     *: *:  *  :   : .*

AT2G18280.1     LLLAARRIRRATCTDFIISLSAKNFSRSSSTYVGKLRSGFLGTKFTIYDNQTASSTA---
pt034249_POPTR_ FLLAARKCRRPTCTDYIISLDTDDMSKGSNTYAGKLRSNFLGTKFTVFDGQPPHAGAKMT
pt039357_POPTR_ FLLSAKRKRRTACTEYVISMDADNVSRSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLA
pt000711_POPTR_ FLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLA
pt041132_POPTR_ FLLAARKCRRPTCTDYIISLDTDDMSKGSNAYVGKLRSNFLGTKFTVFDGQPPHAGAKMT
pt037558_POPTR_ LLLAARKIRRATCSDFIVSLVSDDFSRASNTYVGKLRSNFLGTKFTMYDCEPTFEVPTQT
pt000710_POPTR_ FLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLA
pt002868_POPTR_ FLLSAKRTRRTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLS
pt000709_POPTR_ FLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLA
pt001717_POPTR_ LLLAAKKIRKATSTDFRISFVGSDFCQTSNTYAGKLRSNFLGTKFTIYDSQPPCPGLKS-
pt001281_POPTR_ LLLAARKIRRATCTDFIVSLVSDDFSRASNTYVGKLRSNFLGTKFTMYDSEPTFEVPRQL
pt037730_POPTR_ VLLAAKKIRKATSTDFRISFAGSDFCQTSNTYVGKLRSNFLGTKFTIYDGQTPCPAMRS-
pt028965_POPTR_ FLLAARRYRQGVHTEYIISLDADDLSQGSNAYVGKLSSDFLGTNFTIYDSQPPHSGAKPS
pt000712_POPTR_ FLLSAKRSRRTTCTEYVISMDADNISKSSSTYIGKLRSNFLGTKFIIYDTQPPYNNAQLA
                .**:*:: *: . ::: :*:  .:..: *.:* *** *.****:* ::* :..       

AT2G18280.1     --QAQPNRRLHPKQAAPKLPTNSSTVGNITYELNVLRTRGPRRMHCAMDSIPLSSVIAEP
pt034249_POPTR_ --KSYSSRLVNLKQVSPRVPTGNYPVANISYELNVLGSRGPRRMHCIMDAIPAAA-IEPG
pt039357_POPTR_ --PPGRSRRFYSKKVSPKVPTGSYNIAQVTYELNVLGTRGPRRMHCTMHSIPALS-LEPG
pt000711_POPTR_ --PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSIPVSS-LEPG
pt041132_POPTR_ --KSRSSRLVNLKQVSPRVPTGNYPVASISYELNVLGSRGPRRMHCIMDAIPASA-IEPG
pt037558_POPTR_ QHANRISRRFHSRQVSPRLPACNYSIGTITYELNVLRSRGPRRMHCMMHSIPMSS-IEEG
pt000710_POPTR_ --PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSIPVSS-LEPG
pt002868_POPTR_ --PPGRSRRFYSKKVSPKVPTGSYNIAQVTYELNVLGTRGPRRMHCTMHSIPASS-LEPG
pt000709_POPTR_ --PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSIPVSS-LEPG
pt001717_POPTR_ --NCKLQQKVRSIQVSPGVPARNFNVATVSYELNVLRTRGPRRMHCIVHSIPISA-IQEG
pt001281_POPTR_ --ASRTSRRFNPRQVSLRLPACNYCIATITYELNVLRSRGPRRMHCIMHSIPMSS-IEEG
pt037730_POPTR_ --NCKPQRKVRSIQVSPGVAARNYNVATVSYELNVLRTRGPRRMHCTIHSIPISA-IQEG
pt028965_POPTR_ --SSRASRRFASKQISPQVPAGNFEVGQVSYKFNLLKSRGPRRMVCSLKC-PVSQ-----
pt000712_POPTR_ --PPGRSRRFYSKKVSPKVPTGSYNIAHVTYELNVLGTRGPRRMHCTMHSIPVSS-LEPG
                      .: .   : :  :.: .  :. ::*::*:* :****** * :.. *        

AT2G18280.1     SVVQGIEE-----------EVSSSPSPKGETI---TTD---KE------IPDNSPSL---
pt034249_POPTR_ GVAPTQTEFYHHSA-DFFPSLLFF---RSKSNRVERVESFQS-------GPLSSQRE--G
pt039357_POPTR_ GSVPGQPELLPRCLEDSFRSISFS---KSIDN---STE-FSSSRFSDIVGPREEDEE--G
pt000711_POPTR_ GSVPGQPELLPCSLEDSFRSISFS---KSIDN---STE-FSSSRFSNIVGPREEDEE--G
pt041132_POPTR_ GIAPTQTEFSHHNV-DFLPSLPFF---RSKSN---RVESFQS-------GSLSSQRE--G
pt037558_POPTR_ GTVPTLTSLTETFG-GQFPHLSTS---KGKES---VSD-ISSP------SPSQSPVLTQG
pt000710_POPTR_ GSVPGQPELLPCSLEDSFRSISFS---KSIDN---STE-FSSSRFSNIVGPREEDEE--G
pt002868_POPTR_ GSVPGQAELLPRSLEDSFRSISFS---KSIDN---STE-FSSSRFSDIVGPR-EDEE--G
pt000709_POPTR_ GSVPGQPELLPCSLEDSFRSISFS---KSIDN---STE-FSSSRFSNIVGPREEDEE--G
pt001717_POPTR_ GVAPTPLEFNNPGD-EQSPSLSAS---KVKQP---LID-FIST------SRAESSDSICS
pt001281_POPTR_ GTVQTLTSIPEAFN-GQFPHLSSS---IGKEL---VSD-NSSA------SPSRSPVLAQG
pt037730_POPTR_ GIAPTPSEFNNPSN-EQSSPLSAS---KLKQP---PID-FSSN------SLAESSDSLCS
pt028965_POPTR_ ---------------------------ETTNVK--NVD-NSKM------TQLESASS--G
pt000712_POPTR_ GSVPGQPELLPCSLEDSFRSISFS---KSIDN---STE-FSSSRFSNIVGPREEDEE--G
                                                     :   .           .      

AT2G18280.1     RDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVAEIDASL-----DAPPE--E
pt034249_POPTR_ A---LVLRNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLVASQE--------NGPAGP-E
pt039357_POPTR_ KERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPAQS-D
pt000711_POPTR_ KERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQPAAGAPTPSQPAQS-D
pt041132_POPTR_ A---LVLKNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLVVSPE--------NGPAGP-E
pt037558_POPTR_ SEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAAVESFH-----NVSSA--D
pt000710_POPTR_ KERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQPAAGAPTPSQPAQS-D
pt002868_POPTR_ KERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPVQS-D
pt000709_POPTR_ KERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQPAAGAPTPSQPAQS-D
pt001717_POPTR_ KMDPLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPCQ-----NVPVE--E
pt001281_POPTR_ SEELLVLKNKAPRWHEQLQCSCLNFRGRVTVASVKNFQLVASAEPSH-----NVPAA--D
pt037730_POPTR_ KNDPLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLVAAVEPCQ-----NVPVE--E
pt028965_POPTR_ F---TVLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLVAIMDQ-------SQPGGKGD
pt000712_POPTR_ KERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLVAATQPAAGAPTPSQPAQS-D
                     :*:**:*****:*** ****:***:*********:.  :        . .    :

AT2G18280.1     HERVILQFGKIGKDIFTMDYRYPLSAFQAFAICISSFDTKPACEG
pt034249_POPTR_ HENIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTKIACE-
pt039357_POPTR_ HDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
pt000711_POPTR_ HDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
pt041132_POPTR_ HENIILQFGKVGKDLFTMDYRYPISAFQAFALCLSSFDTKIACE-
pt037558_POPTR_ QERVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE-
pt000710_POPTR_ HDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
pt002868_POPTR_ HDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
pt000709_POPTR_ HDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
pt001717_POPTR_ QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE-
pt001281_POPTR_ QERVILQFGKIGKDIFTMDYFYPLSAFQAFAICLSSFDTKPACE-
pt037730_POPTR_ QEKVILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTKPACE-
pt028965_POPTR_ EETVLLQFGKVGDDTFTMDYRQPLSAFQAFALCLTSFGTKLACE-
pt000712_POPTR_ HDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
                .: ::*****:*.* *****  *:*******:*::**.** *** 


BoxShade v3.31 C (beta, 970507) Output
AT2G18280.1     - M S L K S I L R D L K E V R D G L - - - - - - G G I S K R S - - - - - - - - W - - S K S S H I A P D - - - - - Q T T -
pt034249_POPTR_    M P A L K S I I N - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S T S H R V V Q Y S S A P E L N L
pt039357_POPTR_    - M S F R S I V R D - - - M R D G F - - - - - - G S L S R R S F E V R L P G H L - - R G K S H - - - - - G S A C E L Q -
pt000711_POPTR_    - M S F R S I V R D - - - M R D G F - - - - - - G S L S R R S F E V R L P G H F - - R G K S H - - - - - G S A C E L L -
pt041132_POPTR_    M S A I K S I I N - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S R S H R V V Q Y S S A P D L S L
pt037558_POPTR_    - M S I K S I V R E L K E M K D G I - - - - - - G N I S R R G L E G K - - - H W R G R A R S H I A P D - - - - - E T P -
pt000710_POPTR_    - M S F R S I V R D - - - M R D G F - - - - - - G S L S R R S F E V R L P G H F - - R G K S H - - - - - G S A C E L L -
pt002868_POPTR_    - M S F R S I V R D - - - M R D G F - - - - - - G S L S R R S F E V R L P G H H - - R G K S H - - - - - S S A C E L H -
pt000709_POPTR_    - M S F R S I V R D - - - M R D G F - - - - - - G S L S R R S F E V R L P G H F - - R G K S H - - - - - G S A C E L L -
pt001717_POPTR_    - M S F K S - - - K L K E I R D D I T T T F S M G K L Q R N R T N R - - - - - - - - R G R A Y I A P E L G G G S E L L -
pt001281_POPTR_    - M S F K S I M R E F K E I K E G I - - - - - - G S I S R R G V E G K - - - H W C G R V R S H I A P D - - - - - E T R -
pt037730_POPTR_    - M S F K G - - - K L K E I R D D I S T T F S M G K L Q R N R T N R - - - - - - - - R G R A Y I A P E L G G G S E L F -
pt028965_POPTR_    - M S L R R - - - - - - - - - - - - - - - - - - S F L S R R F S - - - - - - - - - - R S F N N Q N R N E R N G V E S G R
pt000712_POPTR_    - M S F R S I V R D - - - M R D G F - - - - - - G S L S R R S F E V R L P G H F - - R G K S H - - - - - G S A C E L L -
 
AT2G18280.1     - - P P L D N I P Q S P W A S L P P E L L H D I I W R V E E S E T A W P A R A A V V S C A S V C K S W R G I T M E I V R
pt034249_POPTR_    F A A G G A A E T A S C W A N L P Q E L L R E V L V R I E E S E S S W P P R K N V V A C A G V C R S W R H I T K D L V K
pt039357_POPTR_    - - D Q P V V I Q N S R W A G L P P E L L Q D V I K R L E A S E S T W P S R K H V V A C A S V C R A W R E M C K E I V R
pt000711_POPTR_    - - D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V R
pt041132_POPTR_    F G G G C G A E T T S C W A N L P Q E L L R E V L I R I E E S E S S W P P R K N V V A C A G V C R S W R D I T K E L V K
pt037558_POPTR_    - - A E T D Q I E Q G Q W A N L P P E L L L D I I R R V E E S E T S W P A R A V V V H C A S V C R S W R E I T K E I V K
pt000710_POPTR_    - - D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V R
pt002868_POPTR_    - - D Q P V V I Q N S R W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A A V C S A W R E M C K E I V R
pt000709_POPTR_    - - D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V R
pt001717_POPTR_    - - S E L I E - E Q S P W A N L P P E L L Q D V I K R V E G S E T S W P G R R D V V A C A S V C T S W R E I T K A V V K
pt001281_POPTR_    - - E E T D Q I D Q G Q W A N L P P E L L L D I I M R L E E S E S S W P A R V V V V H C A S V C R S W R E I T K E I V K
pt037730_POPTR_    - - R E L I E - E Q S P W A N L P P E L L H D V I Q R V E G S E T S W P G R R D V V A C A S V C K S W R E I T K T V V K
pt028965_POPTR_    L V G E S G G - E S D G W G S M L P E L L G E I I K R V E E S E D R W P Q R Q N V V A C A C V C K K W R E V T K D I V K
pt000712_POPTR_    - - D Q P V V I Q D S P W A G L P P E L L R D V I K R L E A S E S T W P A R K H V V A C A S V C R A W R E M C K E I V R
 
AT2G18280.1     I - P E - - - - - - Q C G K L T F P I S L K Q P G P R D S P I Q C F I K R N R A T A T Y I L Y Y G L M P S - E T E N D K
pt034249_POPTR_    V - P E - - - - - - L S G K I T F P I S V K Q P G P R E Q L L Q C F I K R C R S T Q T Y R L Y L S L N N A - L T E D G K
pt039357_POPTR_    S - P E - - - - - - F S G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K
pt000711_POPTR_    S - P E - - - - - - F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K
pt041132_POPTR_    V - P E - - - - - - L S G K L T F P I S V K Q P G P R D F L L Q C F I K R C R S A Q T Y R L Y L G L N N A - L T E D G K
pt037558_POPTR_    T - P E - - - - - - Q C G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S - E G E N D K
pt000710_POPTR_    S - P E - - - - - - F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K
pt002868_POPTR_    N - P E - - - - - - F S G K I T F P V S L K Q P G P R D G T I Q C F I K R D K S K L T Y H L F L C L S P A L L V E N G K
pt000709_POPTR_    S - P E - - - - - - F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K
pt001717_POPTR_    T - P E - - - - - - Q C G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y H L Y L G L S P A L S G D M S K
pt001281_POPTR_    T - P E - - - - - - Q C G R L T F P I S L K Q P G P R E S P I Q C F I K R D N A T S T F L L Y Y G L V P S - G G E N D K
pt037730_POPTR_    T - P E - - - - - - Q C G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y L L Y L G L S P A L S G D M N K
pt028965_POPTR_    S L P N N N N N N G S S G K I T F P S C L K Q P G P R D L P H Q C L I K R N K K T S T F Y L Y L A L T P S - F T D K G K
pt000712_POPTR_    S - P E - - - - - - F S G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A L L V E N G K
 
AT2G18280.1     L L L A A R R I R R A T C T D F I I S L S A K N F S R S S S T Y V G K L R S G F L G T K F T I Y D N Q T A S S T A - - -
pt034249_POPTR_    F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N T Y A G K L R S N F L G T K F T V F D G Q P P H A G A K M T
pt039357_POPTR_    F L L S A K R K R R T A C T E Y V I S M D A D N V S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L A
pt000711_POPTR_    F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L A
pt041132_POPTR_    F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N A Y V G K L R S N F L G T K F T V F D G Q P P H A G A K M T
pt037558_POPTR_    L L L A A R K I R R A T C S D F I V S L V S D D F S R A S N T Y V G K L R S N F L G T K F T M Y D C E P T F E V P T Q T
pt000710_POPTR_    F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L A
pt002868_POPTR_    F L L S A K R T R R T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L S
pt000709_POPTR_    F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L A
pt001717_POPTR_    L L L A A K K I R K A T S T D F R I S F V G S D F C Q T S N T Y A G K L R S N F L G T K F T I Y D S Q P P C P G L K S -
pt001281_POPTR_    L L L A A R K I R R A T C T D F I V S L V S D D F S R A S N T Y V G K L R S N F L G T K F T M Y D S E P T F E V P R Q L
pt037730_POPTR_    V L L A A K K I R K A T S T D F R I S F A G S D F C Q T S N T Y V G K L R S N F L G T K F T I Y D G Q T P C P A M R S -
pt028965_POPTR_    F L L A A R R Y R Q G V H T E Y I I S L D A D D L S Q G S N A Y V G K L S S D F L G T N F T I Y D S Q P P H S G A K P S
pt000712_POPTR_    F L L S A K R S R R T T C T E Y V I S M D A D N I S K S S S T Y I G K L R S N F L G T K F I I Y D T Q P P Y N N A Q L A
 
AT2G18280.1     - - Q A Q P N R R L H P K Q A A P K L P T N S S T V G N I T Y E L N V L R T R G P R R M H C A M D S I P L S S V I A E P
pt034249_POPTR_    - - K S Y S S R L V N L K Q V S P R V P T G N Y P V A N I S Y E L N V L G S R G P R R M H C I M D A I P A A A - I E P G
pt039357_POPTR_    - - P P G R S R R F Y S K K V S P K V P T G S Y N I A Q V T Y E L N V L G T R G P R R M H C T M H S I P A L S - L E P G
pt000711_POPTR_    - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I P V S S - L E P G
pt041132_POPTR_    - - K S R S S R L V N L K Q V S P R V P T G N Y P V A S I S Y E L N V L G S R G P R R M H C I M D A I P A S A - I E P G
pt037558_POPTR_    Q H A N R I S R R F H S R Q V S P R L P A C N Y S I G T I T Y E L N V L R S R G P R R M H C M M H S I P M S S - I E E G
pt000710_POPTR_    - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I P V S S - L E P G
pt002868_POPTR_    - - P P G R S R R F Y S K K V S P K V P T G S Y N I A Q V T Y E L N V L G T R G P R R M H C T M H S I P A S S - L E P G
pt000709_POPTR_    - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I P V S S - L E P G
pt001717_POPTR_    - - N C K L Q Q K V R S I Q V S P G V P A R N F N V A T V S Y E L N V L R T R G P R R M H C I V H S I P I S A - I Q E G
pt001281_POPTR_    - - A S R T S R R F N P R Q V S L R L P A C N Y C I A T I T Y E L N V L R S R G P R R M H C I M H S I P M S S - I E E G
pt037730_POPTR_    - - N C K P Q R K V R S I Q V S P G V A A R N Y N V A T V S Y E L N V L R T R G P R R M H C T I H S I P I S A - I Q E G
pt028965_POPTR_    - - S S R A S R R F A S K Q I S P Q V P A G N F E V G Q V S Y K F N L L K S R G P R R M V C S L K C - P V S Q - - - - -
pt000712_POPTR_    - - P P G R S R R F Y S K K V S P K V P T G S Y N I A H V T Y E L N V L G T R G P R R M H C T M H S I P V S S - L E P G
 
AT2G18280.1     S V V Q G I E E - - - - - - - - - - - E V S S S P S P K G E T I - - - T T D - - - K E - - - - - - I P D N S P S L - - -
pt034249_POPTR_    G V A P T Q T E F Y H H S A - D F F P S L L F F - - - R S K S N R V E R V E S F Q S - - - - - - - G P L S S Q R E - - G
pt039357_POPTR_    G S V P G Q P E L L P R C L E D S F R S I S F S - - - K S I D N - - - S T E - F S S S R F S D I V G P R E E D E E - - G
pt000711_POPTR_    G S V P G Q P E L L P C S L E D S F R S I S F S - - - K S I D N - - - S T E - F S S S R F S N I V G P R E E D E E - - G
pt041132_POPTR_    G I A P T Q T E F S H H N V - D F L P S L P F F - - - R S K S N - - - R V E S F Q S - - - - - - - G S L S S Q R E - - G
pt037558_POPTR_    G T V P T L T S L T E T F G - G Q F P H L S T S - - - K G K E S - - - V S D - I S S P - - - - - - S P S Q S P V L T Q G
pt000710_POPTR_    G S V P G Q P E L L P C S L E D S F R S I S F S - - - K S I D N - - - S T E - F S S S R F S N I V G P R E E D E E - - G
pt002868_POPTR_    G S V P G Q A E L L P R S L E D S F R S I S F S - - - K S I D N - - - S T E - F S S S R F S D I V G P R - E D E E - - G
pt000709_POPTR_    G S V P G Q P E L L P C S L E D S F R S I S F S - - - K S I D N - - - S T E - F S S S R F S N I V G P R E E D E E - - G
pt001717_POPTR_    G V A P T P L E F N N P G D - E Q S P S L S A S - - - K V K Q P - - - L I D - F I S T - - - - - - S R A E S S D S I C S
pt001281_POPTR_    G T V Q T L T S I P E A F N - G Q F P H L S S S - - - I G K E L - - - V S D - N S S A - - - - - - S P S R S P V L A Q G
pt037730_POPTR_    G I A P T P S E F N N P S N - E Q S S P L S A S - - - K L K Q P - - - P I D - F S S N - - - - - - S L A E S S D S L C S
pt028965_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - E T T N V K - - N V D - N S K M - - - - - - T Q L E S A S S - - G
pt000712_POPTR_    G S V P G Q P E L L P C S L E D S F R S I S F S - - - K S I D N - - - S T E - F S S S R F S N I V G P R E E D E E - - G
 
AT2G18280.1     R D Q P L V L K N K S P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A E I D A S L - - - - - D A P P E - - E
pt034249_POPTR_    A - - - L V L R N K A P R W H E Q L Q C W C L N F H G R V T V A S V K N F Q L V A S Q E - - - - - - - - N G P A G P - E
pt039357_POPTR_    K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P A A G A P T P S Q P A Q S - D
pt000711_POPTR_    K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P A A G A P T P S Q P A Q S - D
pt041132_POPTR_    A - - - L V L K N K A P R W H E Q L Q C W C L N F H G R V T V A S V K N F Q L V V S P E - - - - - - - - N G P A G P - E
pt037558_POPTR_    S E E P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A V E S F H - - - - - N V S S A - - D
pt000710_POPTR_    K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P A A G A P T P S Q P A Q S - D
pt002868_POPTR_    K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L I A A T Q P A A G A P T P S Q P V Q S - D
pt000709_POPTR_    K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P A A G A P T P S Q P A Q S - D
pt001717_POPTR_    K M D P L V L K N K A P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A V E P C Q - - - - - N V P V E - - E
pt001281_POPTR_    S E E L L V L K N K A P R W H E Q L Q C S C L N F R G R V T V A S V K N F Q L V A S A E P S H - - - - - N V P A A - - D
pt037730_POPTR_    K N D P L I L K N K A P R W H E Q L Q C W C L N F K G R V T V A S V K N F Q L V A A V E P C Q - - - - - N V P V E - - E
pt028965_POPTR_    F - - - T V L R N K A P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A I M D Q - - - - - - - S Q P G G K G D
pt000712_POPTR_    K E R P L V L R N K S P R W H E Q L Q C W C L N F R G R V S V A S V K N F Q L V A A T Q P A A G A P T P S Q P A Q S - D
 
AT2G18280.1     H E R V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C I S S F D T K P A C E G
pt034249_POPTR_    H E N I I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E -
pt039357_POPTR_    H D K I I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
pt000711_POPTR_    H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
pt041132_POPTR_    H E N I I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A L C L S S F D T K I A C E -
pt037558_POPTR_    Q E R V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E -
pt000710_POPTR_    H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
pt002868_POPTR_    H D K I I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
pt000709_POPTR_    H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
pt001717_POPTR_    Q E K V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E -
pt001281_POPTR_    Q E R V I L Q F G K I G K D I F T M D Y F Y P L S A F Q A F A I C L S S F D T K P A C E -
pt037730_POPTR_    Q E K V I L Q F G K I G K D I F T M D Y R Y P L S A F Q A F A I C L S S F D T K P A C E -
pt028965_POPTR_    E E T V L L Q F G K V G D D T F T M D Y R Q P L S A F Q A F A L C L T S F G T K L A C E -
pt000712_POPTR_    H D K V I L Q F G K V G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
 
0