fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT2G18280.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os009468 not found in 428aa AT2G18280.2 1st_not 0.549071618 II
Os009471 not found in 416aa AT2G18280.2 not_not 0.526525198 III
Os021774 not found in 445aa AT1G25280.1 not_not 0.497347480 III
Os021773 not found in 445aa AT1G25280.1 not_not 0.497347480 III
Os040209 not found in 445aa AT1G25280.1 not_not 0.492042440 III
Os029490 not found in 406aa AT2G47900.2 not_not 0.490716180 III
Os029491 not found in 406aa AT2G47900.2 not_not 0.490716180 III
Os029803 not found in 451aa AT1G25280.1 not_not 0.486737400 III
Os004869 not found in 448aa AT1G25280.1 not_not 0.468169761 III
Os019651 not found in 462aa AT1G25280.1 not_not 0.466843501 III
Os019649 not found in 462aa AT1G25280.1 not_not 0.466843501 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT2G18280.1     MSLKSILRDLKEVRDGLGGISKRSWS---------------KSSHIAP----DQTTPPLD
Os019651_Os04t0 MSFRSIVRD---FRDSFGTLSKRSFEVKIS---GFSGRHRGKSIGPSS----ELDDTPV-
Os019649_Os04t0 MSFRSIVRD---FRDSFGTLSKRSFEVKIS---GFSGRHRGKSIGPSS----ELDDTPV-
Os029490_Os07t0 MSFRSVIQE---VKGEIGAISRRGFRSR-------PGRVR-RVAAAAE----EPPDESSA
Os021774_Os05t0 MSFRSIVRD---VRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTVH----ELCDADL-
Os029803_Os08t0 MSFRSIVRD---VRDSFGSLSRRSFEVRISGLPGLSGHHRGKSLGSLS----ELRDRPV-
Os004869_Os01t0 MSFRSIVRD---VRDGFGSLSRRSFEVTLASLYGLTGHHKGKTQSSLD----ELDDSPA-
Os021773_Os05t0 MSFRSIVRD---VRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTVH----ELCDADL-
Os009468_Os02t0 MSLKSIVRELREMRDGIGSMSRRAADGR-------AGGGRGGSRHSWPVLWSEQQQPPQQ
Os040209_Os12t0 MSFRSIVRD---VRDGFGSLSRRGFEVRLV------GHRRGRSHSAVH----ELRDGHAA
Os009471_Os02t0 ------------MRDGIGSMSRRAADGR-------AGGGRGGSRHSWPVLWSEQQQPPQQ
Os029491_Os07t0 MSFRSVIQE---VKGEIGAISRRGFRSR-------PGRVR-RVAAAAE----EPPDESSA
                            .:. :* :*:*.                            :       

AT2G18280.1     --------NIPQSPWASLPPELLHDIIWRVEESETAWPARAAVVSCASVCKSWRGITMEI
Os019651_Os04t0 --------VAQQSKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTWRDMCKDI
Os019649_Os04t0 --------VAQQSKWAGLPPELLRDVMKRLEEDDSNWPSRKDVVACASVCTTWRDMCKDI
Os029490_Os07t0 AAL-----VMRESCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIVREI
Os021774_Os05t0 --------IIQESRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEI
Os029803_Os08t0 --------VVDQSRWVGLPPELLRDVMKRLEEGESNWPSRKDVVACAAVCRTWREICKDI
Os004869_Os01t0 --------IIPESRWASLPPELLREVIRRLEADESTWPSRRNVVCFAAVCRTWREMCKET
Os021773_Os05t0 --------IIQESRWASLPPELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEI
Os009468_Os02t0 QQLQRQEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVTKEV
Os040209_Os12t0 AAAA---DVVQSSCWANLPPELLRDVIERLEASEAAWPSRKNVVACAAVCRTWRDMCREI
Os009471_Os02t0 QQLQRQEHQQQQGRWANLPPELLLDVIQRVEASEATWPARRQVVACAAVCRSWREVTKEV
Os029491_Os07t0 AAL-----VMRESCWTQLPPELLREVLARVEESEGWWPRRRDVVACAGVCRSWRGIVREI
                           .. *. ****** ::: *:* .:  ** *  **. *.** :** :  : 

AT2G18280.1     VRIPEQCGKLTFPISLKQPGPRDSPIQCFIKRNRATATYILYYGLMPS-ETENDKLLLAA
Os019651_Os04t0 VRNPEFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKFLLSA
Os019649_Os04t0 VRNPEFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKFLLSA
Os029490_Os07t0 VRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKFLLAA
Os021774_Os05t0 VLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFLLSA
Os029803_Os08t0 VQSPEICGKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPAVLSENGKFLLAA
Os004869_Os01t0 VLSPEFCGKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNVVTAEGGKFVLAA
Os021773_Os05t0 VLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKFLLSA
Os009468_Os02t0 VKTLEECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAA
Os040209_Os12t0 VKNPEFCGKITFPVSLKQPGPRNGAIQCFIKRDKSTQTYNLYLCLSSAVLVESGKFLLSA
Os009471_Os02t0 VKTLEECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKLLLAA
Os029491_Os07t0 VRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKFLLAA
                *   * .*.:***:*:******:  ::*:: *:::. ** **  *      : .*::*:*

AT2G18280.1     RRIRRATCTDFIISLSAKNFSRSSSTYVGKLRSGFLGTKFTIYDNQ----TASSTAQAQP
Os019651_Os04t0 KRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCSQERT
Os019649_Os04t0 KRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCSQERT
Os029490_Os07t0 RKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPY-AGDVISKGQS
Os021774_Os05t0 KRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPPVGRS
Os029803_Os08t0 KRNRRATSTEYIISVDSKNISRSSNGYVGKMRSNFLGTKFVVYDTQPPYNAGSLMSCQHG
Os004869_Os01t0 KRHRKTTCTEYTISMVSGNISRSSRTNIGKLRSNFLGTKFIIYDTQPPYNGAVVPHVGRT
Os021773_Os05t0 KRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPPVGRS
Os009468_Os02t0 RKIRRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPC-DAVVLPNNRP
Os040209_Os12t0 KRYSRATCTEYTIFMSADNTSRSSNMYIGKLRSNLLGTKFVIYDTQPPCNTANVSQSGKT
Os009471_Os02t0 RKIRRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPC-DAVVLPNNRP
Os029491_Os07t0 RKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPY-AGDVISKGQS
                ::  ::* *.: * :   : *  :   :**::..:***** ::* :            : 

AT2G18280.1     NRRLHPKQAAPKLPTNSSTVGNITYELNVLRTRGPRRMHCAMDSIPLSSVIAEPSVVQGI
Os019651_Os04t0 SRRFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAV----------
Os019649_Os04t0 SRRFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAV----------
Os029490_Os07t0 ARVIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAI----------
Os021774_Os05t0 SRRFNSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSV----------
Os029803_Os08t0 SRRISSRRVSPKLPTGSYPIAHVKYELNVLGTRGPRRMQCTMHSIPASAV----------
Os004869_Os01t0 SKRFNSTKVSPKVPSVTYNIAQVSYELNVLGTRGPRRMRCMMHSIPASSV----------
Os021773_Os05t0 SRRFNSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSV----------
Os009468_Os02t0 SKR-HFKQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCI----------
Os040209_Os12t0 SRRFYSRKVSPKNPSSTYSIAQVSYELNVLGTRGPRRMNCVMHSIPASSL----------
Os009471_Os02t0 SKR-HFKQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCI----------
Os029491_Os07t0 ARVIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAI----------
                 :     : :*: *     :  :.***.** .******.* *.***  .:          

AT2G18280.1     EEEVSSSPSPKG--ETITTDKEIPDNSPS-------------------------------
Os019651_Os04t0 -EPGGIVPGQPKELLPRLFEESFRSMATSFSKY---------SITDHST------DFSSS
Os019649_Os04t0 -EPGGIVPGQPKELLPRLFEESFRSMATSFSKY---------SITDHST------DFSSS
Os029490_Os07t0 -EQGGTAPTQTE--FPLSYHESFTSI--PFFKS-------------KSV------RANNS
Os021774_Os05t0 -EPGGIVPGQPEQIVPRAFEESFRST-TSFSKS---------SIMDRSMDFSSSRDFSSA
Os029803_Os08t0 -DPEGVVPGQPEQLLPGPFEESFRSTNTS-SRF---------SFMDRSL------DFSSS
Os004869_Os01t0 -EPGGIVPGQPEQIVPRALEDSFRST-TSFSQSFRSTTSFSKSIMDPSM------DFSSA
Os021773_Os05t0 -EPGGIVPGQPEQIVPRAFEESFRST-TSFSKS---------SIMDRSMDFSSSRDFSSA
Os009468_Os02t0 -QEGGKAPTPTG--IIHSLDEQVPALSTSKGKE-------------PAI------EFSST
Os040209_Os12t0 -EAGGTVPCQPDSVLARSLDESFGSI--SFSKS---------SIMDRSI------RFSSS
Os009471_Os02t0 -QEGGKAPTPTG--IIHSLDEQVPALSTSKGKE-------------PAI------EFSST
Os029491_Os07t0 -EQGGTAPTQTE--FPLSYHESFTSI--PFFKS-------------KSV------RANNS
                 :  .  *           ....     .                               

AT2G18280.1     --------------------------LRDQPLVLKNKSPRWHEQLQCWCLNFKGRVTVAS
Os019651_Os04t0 RFS-EFG-GGALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
Os019649_Os04t0 RFS-EFG-GGALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVAS
Os029490_Os07t0 TAS-LLT-----------QNGSK--------LVLKNKSPRWHEHLQCWCLNFHGRVTVAS
Os021774_Os05t0 RFS-DIA-GGT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIAS
Os029803_Os08t0 RFS-EIS-GSANQ-----QGEDDIPEAKERPLVLRNKVPRWHEQLQCWCLNFRGRVTVAS
Os004869_Os01t0 RFS-DIS-GSI-------MGGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIAS
Os021773_Os05t0 RFS-DIA-GGT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIAS
Os009468_Os02t0 SLSADLS-GPV--------------CTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
Os040209_Os12t0 RYS-DISVGGPMVGG---QALGDSDESKERPLILRNKAPRWHEQLQCWCLNFKGRVTVAS
Os009471_Os02t0 SLSADLS-GPV--------------CTNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVAS
Os029491_Os07t0 TAS-LLT-----------QNGSK--------LVLKNKSPRWHEHLQCWCLNFHGRVTVAS
                                               *:*:** *****:********:****:**

AT2G18280.1     VKNFQLVAEID---------ASLDAPPEE------------------HERVILQFGKIGK
Os019651_Os04t0 VKNFQLIAAAPQPSSGAASEPSQAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAK
Os019649_Os04t0 VKNFQLIAAAPQPSSGAASEPSQAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAK
Os029490_Os07t0 VKNFQLVA------------SDESNPTNQ-----------------EHDDVILQFGKVGK
Os021774_Os05t0 VKNFQLIAAPAQPPAGAPT-PSQPAPPEQ-------------------DKIILQFGKVAK
Os029803_Os08t0 VKNFQLIAAA----------SSESSQLEQQQQQQQQNHASSSSSASDHGKVILQFGKVGK
Os004869_Os01t0 VKNFQLVAAPSPPPAGAPT-PSQPGPADP-------------------EKVILQFGKVAR
Os021773_Os05t0 VKNFQLIAAPAQPPAGAPT-PSQPAPPEQ-------------------DKIILQFGKVAK
Os009468_Os02t0 VKNFQLVASVD---------PSLGIPAAE------------------QEKVILQFGKIGK
Os040209_Os12t0 VKNFQLVAAT-QPAAGAPT-PSQPAPPPP----------------PDHDKVILQFGKVAK
Os009471_Os02t0 VKNFQLVASVD---------PSLGIPAAE------------------QEKVILQFGKIGK
Os029491_Os07t0 VKNFQLVA------------SDESNPTNQ-----------------EHDDVILQFGKVGK
                ******:*            ..                            :******:.:

AT2G18280.1     DIFTMDYRYPLSAFQAFAICISSFDTKPACEG
Os019651_Os04t0 DMFTMDYRYPLSAFQAFAICLTSFDTKLACE-
Os019649_Os04t0 DMFTMDYRYPLSAFQAFAICLTSFDTKLACE-
Os029490_Os07t0 DMFTMDYRYPISAFQAFAICLSSFDTKIACE-
Os021774_Os05t0 DMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
Os029803_Os08t0 DMFTMDYRYPLSAFQAFAICLTSFDTKLACE-
Os004869_Os01t0 DMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
Os021773_Os05t0 DMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
Os009468_Os02t0 DIFTMDYRYPLSAFQAFAICLTSFDTKPACE-
Os040209_Os12t0 DMFTMDYRYPLSAFQAFAICLSSFDTKLACE-
Os009471_Os02t0 DIFTMDYRYPLSAFQAFAICLTSFDTKPACE-
Os029491_Os07t0 DMFTMDYRYPISAFQAFAICLSSFDTKIACE-
                *:********:*********::***** *** 


BoxShade v3.31 C (beta, 970507) Output
AT2G18280.1     M S L K S I L R D L K E V R D G L G G I S K R S W S - - - - - - - - - - - - - - - K S S H I A P - - - - D Q T T P P L D
Os019651_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F E V K I S - - - G F S G R H R G K S I G P S S - - - - E L D D T P V -
Os019649_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F E V K I S - - - G F S G R H R G K S I G P S S - - - - E L D D T P V -
Os029490_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F R S R - - - - - - - P G R V R - R V A A A A E - - - - E P P D E S S A
Os021774_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V H - - - - E L C D A D L -
Os029803_Os08t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V R I S G L P G L S G H H R G K S L G S L S - - - - E L R D R P V -
Os004869_Os01t0    M S F R S I V R D - - - V R D G F G S L S R R S F E V T L A S L Y G L T G H H K G K T Q S S L D - - - - E L D D S P A -
Os021773_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F E V T L A G L S G L T G H H R G K S Q S T V H - - - - E L C D A D L -
Os009468_Os02t0    M S L K S I V R E L R E M R D G I G S M S R R A A D G R - - - - - - - A G G G R G G S R H S W P V L W S E Q Q Q P P Q Q
Os040209_Os12t0    M S F R S I V R D - - - V R D G F G S L S R R G F E V R L V - - - - - - G H R R G R S H S A V H - - - - E L R D G H A A
Os009471_Os02t0    - - - - - - - - - - - - M R D G I G S M S R R A A D G R - - - - - - - A G G G R G G S R H S W P V L W S E Q Q Q P P Q Q
Os029491_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F R S R - - - - - - - P G R V R - R V A A A A E - - - - E P P D E S S A
 
AT2G18280.1     - - - - - - - - N I P Q S P W A S L P P E L L H D I I W R V E E S E T A W P A R A A V V S C A S V C K S W R G I T M E I
Os019651_Os04t0    - - - - - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W R D M C K D I
Os019649_Os04t0    - - - - - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N W P S R K D V V A C A S V C T T W R D M C K D I
Os029490_Os07t0    A A L - - - - - V M R E S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W R G I V R E I
Os021774_Os05t0    - - - - - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C K E I
Os029803_Os08t0    - - - - - - - - V V D Q S R W V G L P P E L L R D V M K R L E E G E S N W P S R K D V V A C A A V C R T W R E I C K D I
Os004869_Os01t0    - - - - - - - - I I P E S R W A S L P P E L L R E V I R R L E A D E S T W P S R R N V V C F A A V C R T W R E M C K E T
Os021773_Os05t0    - - - - - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T W P S R K D V V S C A A V C K A W R E M C K E I
Os009468_Os02t0    Q Q L Q R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T K E V
Os040209_Os12t0    A A A A - - - D V V Q S S C W A N L P P E L L R D V I E R L E A S E A A W P S R K N V V A C A A V C R T W R D M C R E I
Os009471_Os02t0    Q Q L Q R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T W P A R R Q V V A C A A V C R S W R E V T K E V
Os029491_Os07t0    A A L - - - - - V M R E S C W T Q L P P E L L R E V L A R V E E S E G W W P R R R D V V A C A G V C R S W R G I V R E I
 
AT2G18280.1     V R I P E Q C G K L T F P I S L K Q P G P R D S P I Q C F I K R N R A T A T Y I L Y Y G L M P S - E T E N D K L L L A A
Os019651_Os04t0    V R N P E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F L L S A
Os019649_Os04t0    V R N P E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F L L S A
Os029490_Os07t0    V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F L L A A
Os021774_Os05t0    V L S P E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F L L S A
Os029803_Os08t0    V Q S P E I C G K L T F P V S L K Q P G P R D G L I Q C F I K R D K S K L T Y Y L Y L C L S P A V L S E N G K F L L A A
Os004869_Os01t0    V L S P E F C G K L T F P V S I K Q P G P R D G M I Q C Y I K R N R S K S T Y H L Y L C L S N V V T A E G G K F V L A A
Os021773_Os05t0    V L S P E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F L L S A
Os009468_Os02t0    V K T L E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L L L A A
Os040209_Os12t0    V K N P E F C G K I T F P V S L K Q P G P R N G A I Q C F I K R D K S T Q T Y N L Y L C L S S A V L V E S G K F L L S A
Os009471_Os02t0    V K T L E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L L L A A
Os029491_Os07t0    V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F L L A A
 
AT2G18280.1     R R I R R A T C T D F I I S L S A K N F S R S S S T Y V G K L R S G F L G T K F T I Y D N Q - - - - T A S S T A Q A Q P
Os019651_Os04t0    K R S R R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E R T
Os019649_Os04t0    K R S R R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E R T
Os029490_Os07t0    R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y - A G D V I S K G Q S
Os021774_Os05t0    K R H R K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G R S
Os029803_Os08t0    K R N R R A T S T E Y I I S V D S K N I S R S S N G Y V G K M R S N F L G T K F V V Y D T Q P P Y N A G S L M S C Q H G
Os004869_Os01t0    K R H R K T T C T E Y T I S M V S G N I S R S S R T N I G K L R S N F L G T K F I I Y D T Q P P Y N G A V V P H V G R T
Os021773_Os05t0    K R H R K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G R S
Os009468_Os02t0    R K I R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C - D A V V L P N N R P
Os040209_Os12t0    K R Y S R A T C T E Y T I F M S A D N T S R S S N M Y I G K L R S N L L G T K F V I Y D T Q P P C N T A N V S Q S G K T
Os009471_Os02t0    R K I R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C - D A V V L P N N R P
Os029491_Os07t0    R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y - A G D V I S K G Q S
 
AT2G18280.1     N R R L H P K Q A A P K L P T N S S T V G N I T Y E L N V L R T R G P R R M H C A M D S I P L S S V I A E P S V V Q G I
Os019651_Os04t0    S R R F S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V - - - - - - - - - -
Os019649_Os04t0    S R R F S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V - - - - - - - - - -
Os029490_Os07t0    A R V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I - - - - - - - - - -
Os021774_Os05t0    S R R F N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V - - - - - - - - - -
Os029803_Os08t0    S R R I S S R R V S P K L P T G S Y P I A H V K Y E L N V L G T R G P R R M Q C T M H S I P A S A V - - - - - - - - - -
Os004869_Os01t0    S K R F N S T K V S P K V P S V T Y N I A Q V S Y E L N V L G T R G P R R M R C M M H S I P A S S V - - - - - - - - - -
Os021773_Os05t0    S R R F N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V - - - - - - - - - -
Os009468_Os02t0    S K R - H F K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I - - - - - - - - - -
Os040209_Os12t0    S R R F Y S R K V S P K N P S S T Y S I A Q V S Y E L N V L G T R G P R R M N C V M H S I P A S S L - - - - - - - - - -
Os009471_Os02t0    S K R - H F K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I - - - - - - - - - -
Os029491_Os07t0    A R V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I - - - - - - - - - -
 
AT2G18280.1     E E E V S S S P S P K G - - E T I T T D K E I P D N S P S - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    - E P G G I V P G Q P K E L L P R L F E E S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S
Os019649_Os04t0    - E P G G I V P G Q P K E L L P R L F E E S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S
Os029490_Os07t0    - E Q G G T A P T Q T E - - F P L S Y H E S F T S I - - P F F K S - - - - - - - - - - - - - K S V - - - - - - R A N N S
Os021774_Os05t0    - E P G G I V P G Q P E Q I V P R A F E E S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A
Os029803_Os08t0    - D P E G V V P G Q P E Q L L P G P F E E S F R S T N T S - S R F - - - - - - - - - S F M D R S L - - - - - - D F S S S
Os004869_Os01t0    - E P G G I V P G Q P E Q I V P R A L E D S F R S T - T S F S Q S F R S T T S F S K S I M D P S M - - - - - - D F S S A
Os021773_Os05t0    - E P G G I V P G Q P E Q I V P R A F E E S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A
Os009468_Os02t0    - Q E G G K A P T P T G - - I I H S L D E Q V P A L S T S K G K E - - - - - - - - - - - - - P A I - - - - - - E F S S T
Os040209_Os12t0    - E A G G T V P C Q P D S V L A R S L D E S F G S I - - S F S K S - - - - - - - - - S I M D R S I - - - - - - R F S S S
Os009471_Os02t0    - Q E G G K A P T P T G - - I I H S L D E Q V P A L S T S K G K E - - - - - - - - - - - - - P A I - - - - - - E F S S T
Os029491_Os07t0    - E Q G G T A P T Q T E - - F P L S Y H E S F T S I - - P F F K S - - - - - - - - - - - - - K S V - - - - - - R A N N S
 
AT2G18280.1     - - - - - - - - - - - - - - - - - - - - - - - - - - L R D Q P L V L K N K S P R W H E Q L Q C W C L N F K G R V T V A S
Os019651_Os04t0    R F S - E F G - G G A L Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S
Os019649_Os04t0    R F S - E F G - G G A L Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S
Os029490_Os07t0    T A S - L L T - - - - - - - - - - - Q N G S K - - - - - - - - L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S
Os021774_Os05t0    R F S - D I A - G G T - - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S
Os029803_Os08t0    R F S - E I S - G S A N Q - - - - - Q G E D D I P E A K E R P L V L R N K V P R W H E Q L Q C W C L N F R G R V T V A S
Os004869_Os01t0    R F S - D I S - G S I - - - - - - - M G G D D N G E I K E R P L V L R N K P P R W H E Q L Q C W C L N F R G R V T I A S
Os021773_Os05t0    R F S - D I A - G G T - - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S
Os009468_Os02t0    S L S A D L S - G P V - - - - - - - - - - - - - - C T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S
Os040209_Os12t0    R Y S - D I S V G G P M V G G - - - Q A L G D S D E S K E R P L I L R N K A P R W H E Q L Q C W C L N F K G R V T V A S
Os009471_Os02t0    S L S A D L S - G P V - - - - - - - - - - - - - - C T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S
Os029491_Os07t0    T A S - L L T - - - - - - - - - - - Q N G S K - - - - - - - - L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S
 
AT2G18280.1     V K N F Q L V A E I D - - - - - - - - - A S L D A P P E E - - - - - - - - - - - - - - - - - - H E R V I L Q F G K I G K
Os019651_Os04t0    V K N F Q L I A A A P Q P S S G A A S E P S Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F G K V A K
Os019649_Os04t0    V K N F Q L I A A A P Q P S S G A A S E P S Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F G K V A K
Os029490_Os07t0    V K N F Q L V A - - - - - - - - - - - - S D E S N P T N Q - - - - - - - - - - - - - - - - - E H D D V I L Q F G K V G K
Os021774_Os05t0    V K N F Q L I A A P A Q P P A G A P T - P S Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F G K V A K
Os029803_Os08t0    V K N F Q L I A A A - - - - - - - - - - S S E S S Q L E Q Q Q Q Q Q Q Q N H A S S S S S A S D H G K V I L Q F G K V G K
Os004869_Os01t0    V K N F Q L V A A P S P P P A G A P T - P S Q P G P A D P - - - - - - - - - - - - - - - - - - - E K V I L Q F G K V A R
Os021773_Os05t0    V K N F Q L I A A P A Q P P A G A P T - P S Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F G K V A K
Os009468_Os02t0    V K N F Q L V A S V D - - - - - - - - - P S L G I P A A E - - - - - - - - - - - - - - - - - - Q E K V I L Q F G K I G K
Os040209_Os12t0    V K N F Q L V A A T - Q P A A G A P T - P S Q P A P P P P - - - - - - - - - - - - - - - - P D H D K V I L Q F G K V A K
Os009471_Os02t0    V K N F Q L V A S V D - - - - - - - - - P S L G I P A A E - - - - - - - - - - - - - - - - - - Q E K V I L Q F G K I G K
Os029491_Os07t0    V K N F Q L V A - - - - - - - - - - - - S D E S N P T N Q - - - - - - - - - - - - - - - - - E H D D V I L Q F G K V G K
 
AT2G18280.1     D I F T M D Y R Y P L S A F Q A F A I C I S S F D T K P A C E G
Os019651_Os04t0    D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E -
Os019649_Os04t0    D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E -
Os029490_Os07t0    D M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E -
Os021774_Os05t0    D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
Os029803_Os08t0    D M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E -
Os004869_Os01t0    D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
Os021773_Os05t0    D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
Os009468_Os02t0    D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K P A C E -
Os040209_Os12t0    D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E -
Os009471_Os02t0    D I F T M D Y R Y P L S A F Q A F A I C L T S F D T K P A C E -
Os029491_Os07t0    D M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E -
 
0