fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT3G06380.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os029490 not found in 406aa AT2G47900.2 1st_not 0.581529581 II
Sb032660 ACQGAALRLSLAFLDS in 197/692 AT1G25280.1 1st_not 0.509379509 II
SPLIMGLSLMLAGQAE in 382/692
Gm036751 not found in 389aa AT2G47900.2 1st_not 0.597402597 II
Pt041132 not found in 392aa AT2G47900.2 1st_not 0.603174603 II
Pp000633 not found in 474aa AT2G47900.2 1st_not 0.548340548 II
Sm008088 not found in 357aa AT2G47900.2 1st_not 0.520923520 II

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT3G06380.1     ------------------------------------------------------MTFRSL
pt041132_POPTR_ ------------------------------------------------------------
Os029490_Os07t0 ------------------------------------------------------MSFRSV
pp000633_Pp1s10 MLASECLTVHGLRRWLKLWLILLKRSLEGIWCEVSRRELGFCKWTMSGQKSSSMMPLKSL
Sb032660_Sorbi1 -LAK--------------------------------------------------MSFRSI
Sm008088_Selmo1 ------------------------------------------------------------
gm036751_Glyma1 ------------------------------------------------------------
                                                                            

AT3G06380.1     L---QEM-----------------------------RS----------RPHRVVHAAAST
pt041132_POPTR_ ----------MSAIKSIIN-----------------RS----------RSHRVVQYSSAP
Os029490_Os07t0 I---QEVKGEIGAISRRGF-----------------RS----------RPGRVRRVAAAA
pp000633_Pp1s10 IREFQEMKGGIGNISRRSFELKFP-------HHHRGRSSGMVLDESQLRPERV-------
Sb032660_Sorbi1 V---RDVRDSFGSLSRRSFEVTIAGLSGLTVHH---RG----------KSQSTVHEVCDT
Sm008088_Selmo1 -------------MSR--------------------------------------------
gm036751_Glyma1 ----------MGLIRSM-------------------RS----------RSQRVVQEQEAA
                                                                            

AT3G06380.1     A--------------NSSDPFSWSELPEELLREILIRVETVDGGDWPSRRNVVACAGVCR
pt041132_POPTR_ DLSLFGGGC------GAETTSCWANLPQELLREVLIRIEESESS-WPPRKNVVACAGVCR
Os029490_Os07t0 EEPPDESSAAALV----MRESCWTQLPPELLREVLARVEESEGW-WPRRRDVVACAGVCR
pp000633_Pp1s10 -----------------VEQSCWANMPPELLRDVIQRVEVSEST-WPSRKHVVACAAVCS
Sb032660_Sorbi1 D----------LI----IQESRWANLPPELLRDVIRRLEASEST-WPNRKHVVSCAAVCR
Sm008088_Selmo1 -------------------QSCWANMPPELLRDIIQRLESSDNV-WPSRKNVVACAAVCS
gm036751_Glyma1 E-------CVGVVVGDSMRQSCWANMPQELLREVLLRIEASEDT-WPPRKSVVSCAGVCR
                                      *:::* ****::: *:*  :.  ** *: **:**.** 

AT3G06380.1     SWRILTKEIVAVPEFSSKLTFPISLKQSGPRDSLVQCFIKRNRNTQSYHLYLGLTTS-LT
pt041132_POPTR_ SWRDITKELVKVPELSGKLTFPISVKQPGPRDFLLQCFIKRCRSAQTYRLYLGLNNA-LT
Os029490_Os07t0 SWRGIVREIVRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LT
pp000633_Pp1s10 SWREITKELVRTPEQSGRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPS-LI
Sb032660_Sorbi1 AWREMCREIVLSPEFCGKLTFPVSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLM
Sm008088_Selmo1 TWREITKELVKSPELSGKLTFPVSLKQPGPRDATVQCYIERDRTTATYRLFLGLTPT-LT
gm036751_Glyma1 SWRHITKDIVKTPELSSKITFPISVKQPGPRENLLRCFIKRNRSTQTYYLFLSLTST-LA
                :** : :::*  ** ...:***:::**.***:  ::*:* * :.  :* *:: *  : * 

AT3G06380.1     DNGKFLLAASKLKRATCTDYIISLRSDDISKRSNAYLGRMRSNFLGTKFTVFDGS--QTG
pt041132_POPTR_ EDGKFLLAARKCRRPTCTDYIISLDTDDMSKGSNAYVGKLRSNFLGTKFTVFDGQPPHAG
Os029490_Os07t0 DDGKFLLAARKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPYAG
pp000633_Pp1s10 ENGKFLLAARKFRRATSTDYIISLNQEDMSRGSNTYVGKLRSNFLGTKFTIYDSQPPHNR
Sb032660_Sorbi1 ENGKFLLSAKRNRKTTCTEYVISMDAENISRSSSTYIGKLRSNFLGTKFMISDTQPPYNG
Sm008088_Selmo1 ENGKFLLAARKSRRATSTDYIISIDPEDMSRGSSSCVGKLRSNFLGTKFAIYDTQPPHSG
gm036751_Glyma1 EDGKFLLAARKCRRPTCTDYIISLDADDMSKGSNSYVGKLRSNFLGTKFTIYDSQLPHTG
                ::*****:* : ::.*.*:*:**:  :::*: :.: :*::********* : *       

AT3G06380.1     AAKMQKSRSSNFI---KVSPRVPQGSYPIAHISYELNVLGSRGPRRMRCIMDTIPMSIVE
pt041132_POPTR_ AKMT-KSRSSRLVNLKQVSPRVPTGNYPVASISYELNVLGSRGPRRMHCIMDAIPASAIE
Os029490_Os07t0 DVIS-KGQSARVIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAIE
pp000633_Pp1s10 GVAS--NRSSRRIGSKQLTSRVHAGSYNVAHIAYELNVLGTRGPRRMQCMLHTIPMSAME
Sb032660_Sorbi1 AVVPHAGRTSRRFNSKKVSPKVPTGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASAVE
Sm008088_Selmo1 AIAS-TNRAGRRVAAKQVSPKVPAGSYNVAHISYELNVLGTRGPRRMQCTLHAVGAVSMD
gm036751_Glyma1 AKIM-KSRSTRLVNLKQVSPKVPTGNYPVAHISYELNVLGSRGPRRMHCVMDSIPATAIE
                      .:: . .   :::.::  *.* :: ::*******:******:* :.::    ::

AT3G06380.1     S--RGVVASTSIS-------SFSSRSSPVFRSHSKPLRSN------------SASCSD--
pt041132_POPTR_ P---GGIAPTQTEFSHHNV--DFLPSLPFFRSKS--NRVE---------SFQSGSLSS--
Os029490_Os07t0 Q---GGTAPTQTEFPLSYH--ESFTSIPFFKSKS--VRAN---------NS-TASLLT--
pp000633_Pp1s10 S---GGSAPTPTEFTASTLEDTHVAYSGILSSPR--SRAAVVDSSTLDCDFVSGPLT---
Sb032660_Sorbi1 P---GGIVPGQPEQILPRALEESFRSTTSFSKSSIMDRSMDFSSSR---DFSSARFSDIA
Sm008088_Selmo1 SDSEGMAVPASTELAAAPVADDAVGEPGLSSSGG--DR------------YVKGD-----
gm036751_Glyma1 P---GGVAPTQTEFSLNNI--DMFPSFPFFRSKS--NRAE---------NSMSGPLVD--
                    *  ..   .                  .     *              ..      

AT3G06380.1     -----SGNN---LGDPPLVLSNKAPRWHEQLRCWCLNFHGRVTVASVKNFQLVAVSD---
pt041132_POPTR_ ------------QREGALVLKNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLVVSPENGP
Os029490_Os07t0 ------------QNGSKLVLKNKSPRWHEHLQCWCLNFHGRVTVASVKNFQLVASDESNP
pp000633_Pp1s10 -------------KDAPLILKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAATDLPP
Sb032660_Sorbi1 GGAAIAGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLIAAPSPAP
Sm008088_Selmo1 ----------------PLVLKNKSPRWHDQLQCWCLNFRGRVTVASVKNFQLVAAADQPP
gm036751_Glyma1 ------------QKDGMLVLKNKAPRWHEQLQCWCLNFHGRVTIASVKNFQLVASAENGP
                                 *:* **:****::*:******:****:********:.  .   

AT3G06380.1     -----------CEAGQTSERIILQFGKVGKDMFTMDYGYPISAFQAFAICLSSFETRIAC
pt041132_POPTR_ AG-------------PEHENIILQFGKVGKDLFTMDYRYPISAFQAFALCLSSFDTKIAC
Os029490_Os07t0 TN-------------QEHDDVILQFGKVGKDMFTMDYRYPISAFQAFAICLSSFDTKIAC
pp000633_Pp1s10 TN-----------SQNDHDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
Sb032660_Sorbi1 APAARAPTPSSQPVPQDQDKIILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
Sm008088_Selmo1 APV----------CQGEQDKVLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC
gm036751_Glyma1 AG-------------PEHDKIILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTKIAC
                                  : ::*****:.**:***** **:*******:*****:*::**

AT3G06380.1     E
pt041132_POPTR_ E
Os029490_Os07t0 E
pp000633_Pp1s10 E
Sb032660_Sorbi1 E
Sm008088_Selmo1 E
gm036751_Glyma1 E
                *


BoxShade v3.31 C (beta, 970507) Output
AT3G06380.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M T F R S L
pt041132_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029490_Os07t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S V
pp000633_Pp1s10    M L A S E C L T V H G L R R W L K L W L I L L K R S L E G I W C E V S R R E L G F C K W T M S G Q K S S S M M P L K S L
Sb032660_Sorbi1    - L A K - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S F R S I
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
 
AT3G06380.1     L - - - Q E M - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S - - - - - - - - - - R P H R V V H A A A S T
pt041132_POPTR_    - - - - - - - - - - M S A I K S I I N - - - - - - - - - - - - - - - - - R S - - - - - - - - - - R S H R V V Q Y S S A P
Os029490_Os07t0    I - - - Q E V K G E I G A I S R R G F - - - - - - - - - - - - - - - - - R S - - - - - - - - - - R P G R V R R V A A A A
pp000633_Pp1s10    I R E F Q E M K G G I G N I S R R S F E L K F P - - - - - - - H H H R G R S S G M V L D E S Q L R P E R V - - - - - - -
Sb032660_Sorbi1    V - - - R D V R D S F G S L S R R S F E V T I A G L S G L T V H H - - - R G - - - - - - - - - - K S Q S T V H E V C D T
Sm008088_Selmo1    - - - - - - - - - - - - - M S R - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036751_Glyma1    - - - - - - - - - - M G L I R S M - - - - - - - - - - - - - - - - - - - R S - - - - - - - - - - R S Q R V V Q E Q E A A
 
AT3G06380.1     A - - - - - - - - - - - - - - N S S D P F S W S E L P E E L L R E I L I R V E T V D G G D W P S R R N V V A C A G V C R
pt041132_POPTR_    D L S L F G G G C - - - - - - G A E T T S C W A N L P Q E L L R E V L I R I E E S E S S - W P P R K N V V A C A G V C R
Os029490_Os07t0    E E P P D E S S A A A L V - - - - M R E S C W T Q L P P E L L R E V L A R V E E S E G W - W P R R R D V V A C A G V C R
pp000633_Pp1s10    - - - - - - - - - - - - - - - - - V E Q S C W A N M P P E L L R D V I Q R V E V S E S T - W P S R K H V V A C A A V C S
Sb032660_Sorbi1    D - - - - - - - - - - L I - - - - I Q E S R W A N L P P E L L R D V I R R L E A S E S T - W P N R K H V V S C A A V C R
Sm008088_Selmo1    - - - - - - - - - - - - - - - - - - - Q S C W A N M P P E L L R D I I Q R L E S S D N V - W P S R K N V V A C A A V C S
gm036751_Glyma1    E - - - - - - - C V G V V V G D S M R Q S C W A N M P Q E L L R E V L L R I E A S E D T - W P P R K S V V S C A G V C R
 
AT3G06380.1     S W R I L T K E I V A V P E F S S K L T F P I S L K Q S G P R D S L V Q C F I K R N R N T Q S Y H L Y L G L T T S - L T
pt041132_POPTR_    S W R D I T K E L V K V P E L S G K L T F P I S V K Q P G P R D F L L Q C F I K R C R S A Q T Y R L Y L G L N N A - L T
Os029490_Os07t0    S W R G I V R E I V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T
pp000633_Pp1s10    S W R E I T K E L V R T P E Q S G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S - L I
Sb032660_Sorbi1    A W R E M C R E I V L S P E F C G K L T F P V S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L M
Sm008088_Selmo1    T W R E I T K E L V K S P E L S G K L T F P V S L K Q P G P R D A T V Q C Y I E R D R T T A T Y R L F L G L T P T - L T
gm036751_Glyma1    S W R H I T K D I V K T P E L S S K I T F P I S V K Q P G P R E N L L R C F I K R N R S T Q T Y Y L F L S L T S T - L A
 
AT3G06380.1     D N G K F L L A A S K L K R A T C T D Y I I S L R S D D I S K R S N A Y L G R M R S N F L G T K F T V F D G S - - Q T G
pt041132_POPTR_    E D G K F L L A A R K C R R P T C T D Y I I S L D T D D M S K G S N A Y V G K L R S N F L G T K F T V F D G Q P P H A G
Os029490_Os07t0    D D G K F L L A A R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y A G
pp000633_Pp1s10    E N G K F L L A A R K F R R A T S T D Y I I S L N Q E D M S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H N R
Sb032660_Sorbi1    E N G K F L L S A K R N R K T T C T E Y V I S M D A E N I S R S S S T Y I G K L R S N F L G T K F M I S D T Q P P Y N G
Sm008088_Selmo1    E N G K F L L A A R K S R R A T S T D Y I I S I D P E D M S R G S S S C V G K L R S N F L G T K F A I Y D T Q P P H S G
gm036751_Glyma1    E D G K F L L A A R K C R R P T C T D Y I I S L D A D D M S K G S N S Y V G K L R S N F L G T K F T I Y D S Q L P H T G
 
AT3G06380.1     A A K M Q K S R S S N F I - - - K V S P R V P Q G S Y P I A H I S Y E L N V L G S R G P R R M R C I M D T I P M S I V E
pt041132_POPTR_    A K M T - K S R S S R L V N L K Q V S P R V P T G N Y P V A S I S Y E L N V L G S R G P R R M H C I M D A I P A S A I E
Os029490_Os07t0    D V I S - K G Q S A R V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I E
pp000633_Pp1s10    G V A S - - N R S S R R I G S K Q L T S R V H A G S Y N V A H I A Y E L N V L G T R G P R R M Q C M L H T I P M S A M E
Sb032660_Sorbi1    A V V P H A G R T S R R F N S K K V S P K V P T G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S A V E
Sm008088_Selmo1    A I A S - T N R A G R R V A A K Q V S P K V P A G S Y N V A H I S Y E L N V L G T R G P R R M Q C T L H A V G A V S M D
gm036751_Glyma1    A K I M - K S R S T R L V N L K Q V S P K V P T G N Y P V A H I S Y E L N V L G S R G P R R M H C V M D S I P A T A I E
 
AT3G06380.1     S - - R G V V A S T S I S - - - - - - - S F S S R S S P V F R S H S K P L R S N - - - - - - - - - - - - S A S C S D - -
pt041132_POPTR_    P - - - G G I A P T Q T E F S H H N V - - D F L P S L P F F R S K S - - N R V E - - - - - - - - - S F Q S G S L S S - -
Os029490_Os07t0    Q - - - G G T A P T Q T E F P L S Y H - - E S F T S I P F F K S K S - - V R A N - - - - - - - - - N S - T A S L L T - -
pp000633_Pp1s10    S - - - G G S A P T P T E F T A S T L E D T H V A Y S G I L S S P R - - S R A A V V D S S T L D C D F V S G P L T - - -
Sb032660_Sorbi1    P - - - G G I V P G Q P E Q I L P R A L E E S F R S T T S F S K S S I M D R S M D F S S S R - - - D F S S A R F S D I A
Sm008088_Selmo1    S D S E G M A V P A S T E L A A A P V A D D A V G E P G L S S S G G - - D R - - - - - - - - - - - - Y V K G D - - - - -
gm036751_Glyma1    P - - - G G V A P T Q T E F S L N N I - - D M F P S F P F F R S K S - - N R A E - - - - - - - - - N S M S G P L V D - -
 
AT3G06380.1     - - - - - S G N N - - - L G D P P L V L S N K A P R W H E Q L R C W C L N F H G R V T V A S V K N F Q L V A V S D - - -
pt041132_POPTR_    - - - - - - - - - - - - Q R E G A L V L K N K A P R W H E Q L Q C W C L N F H G R V T V A S V K N F Q L V V S P E N G P
Os029490_Os07t0    - - - - - - - - - - - - Q N G S K L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V K N F Q L V A S D E S N P
pp000633_Pp1s10    - - - - - - - - - - - - - K D A P L I L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N F Q L V A A T D L P P
Sb032660_Sorbi1    G G A A I A G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V K N F Q L I A A P S P A P
Sm008088_Selmo1    - - - - - - - - - - - - - - - - P L V L K N K S P R W H D Q L Q C W C L N F R G R V T V A S V K N F Q L V A A A D Q P P
gm036751_Glyma1    - - - - - - - - - - - - Q K D G M L V L K N K A P R W H E Q L Q C W C L N F H G R V T I A S V K N F Q L V A S A E N G P
 
AT3G06380.1     - - - - - - - - - - - C E A G Q T S E R I I L Q F G K V G K D M F T M D Y G Y P I S A F Q A F A I C L S S F E T R I A C
pt041132_POPTR_    A G - - - - - - - - - - - - - P E H E N I I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A L C L S S F D T K I A C
Os029490_Os07t0    T N - - - - - - - - - - - - - Q E H D D V I L Q F G K V G K D M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C
pp000633_Pp1s10    T N - - - - - - - - - - - S Q N D H D K V L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
Sb032660_Sorbi1    A P A A R A P T P S S Q P V P Q D Q D K I I L Q F G K V A K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
Sm008088_Selmo1    A P V - - - - - - - - - - C Q G E Q D K V L L Q F G K I G K D M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C
gm036751_Glyma1    A G - - - - - - - - - - - - - P E H D K I I L Q F G K V G K D L F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C
 
AT3G06380.1     E
pt041132_POPTR_    E
Os029490_Os07t0    E
pp000633_Pp1s10    E
Sb032660_Sorbi1    E
Sm008088_Selmo1    E
gm036751_Glyma1    E
 
0