fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT3G06380.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os029491 not found in 406aa AT2G47900.2 not_not 0.581529581 III
Os040209 not found in 445aa AT1G25280.1 not_not 0.516594516 III
Os029803 not found in 451aa AT1G25280.1 not_not 0.513708513 III
Os021774 not found in 445aa AT1G25280.1 not_not 0.513708513 III
Os021773 not found in 445aa AT1G25280.1 not_not 0.513708513 III
Os004869 not found in 448aa AT1G25280.1 not_not 0.494949494 III
Os019651 not found in 462aa AT1G25280.1 not_not 0.493506493 III
Os019649 not found in 462aa AT1G25280.1 not_not 0.493506493 III
Os009471 not found in 416aa AT2G18280.2 not_not 0.484848484 III
Os009468 not found in 428aa AT2G18280.2 not_not 0.484848484 III
Os003208 not found in 356aa AT1G53320.1 not_not 0.428571428 III
Os003209 not found in 356aa AT1G53320.1 not_not 0.428571428 III
Os022387 not found in 372aa AT1G53320.1 not_not 0.421356421 III
Os022386 not found in 372aa AT1G53320.1 not_not 0.421356421 III
Os022798 not found in 352aa AT1G53320.1 not_not 0.414141414 III
Sb027814 not found in 706aa AT2G18280.2 not_not 0.483405483 III
Sb024300 not found in 556aa AT2G47900.2 not_not 0.479076479 III
Sb028483 VSVFVELKLTLSSSSS in 564/671 AT1G76900.2 not_not 0.457431457 III
Sb025595 not found in 481aa AT1G53320.1 not_not 0.437229437 III
Sb019095 not found in 351aa AT1G53320.1 not_not 0.412698412 III
Sb032884 not found in 513aa AT1G53320.1 not_not 0.405483405 III
Gm041730 not found in 385aa AT2G47900.2 not_not 0.595959595 III
Gm019438 not found in 359aa AT2G47900.2 not_not 0.562770562 III
Gm004126 not found in 400aa AT2G47900.2 not_not 0.558441558 III
Gm045746 not found in 362aa AT2G47900.2 not_not 0.555555555 III
Gm045745 not found in 362aa AT2G47900.2 not_not 0.555555555 III
Gm045744 not found in 392aa AT2G47900.2 not_not 0.533910533 III
Gm028527 not found in 430aa AT1G25280.1 not_not 0.512265512 III
Gm028526 not found in 430aa AT1G25280.1 not_not 0.512265512 III
Gm054929 not found in 430aa AT1G25280.1 not_not 0.509379509 III
Gm054928 not found in 430aa AT1G25280.1 not_not 0.509379509 III
Gm041219 not found in 427aa AT1G25280.1 not_not 0.507936507 III
Gm021743 not found in 427aa AT1G25280.1 not_not 0.506493506 III
Gm021742 not found in 427aa AT1G25280.1 not_not 0.506493506 III
Gm021741 not found in 427aa AT1G25280.1 not_not 0.506493506 III
Gm021740 not found in 427aa AT1G25280.1 not_not 0.506493506 III
Gm044960 not found in 424aa AT1G25280.1 not_not 0.505050505 III
Gm044959 not found in 424aa AT1G25280.1 not_not 0.505050505 III
Gm003397 not found in 424aa AT1G25280.1 not_not 0.502164502 III
Gm003395 not found in 424aa AT1G25280.1 not_not 0.502164502 III
Gm036752 not found in 290aa AT2G47900.2 not_not 0.496392496 III
Gm030081 not found in 414aa AT2G18280.2 not_not 0.494949494 III
Gm030080 not found in 414aa AT2G18280.2 not_not 0.494949494 III
Gm044675 not found in 414aa AT2G18280.2 not_not 0.493506493 III
Gm003133 not found in 414aa AT2G18280.2 not_not 0.493506493 III
Gm001764 not found in 415aa AT2G18280.2 not_not 0.493506493 III
Gm039266 not found in 423aa AT1G47270.1 not_not 0.480519480 III
Gm039265 not found in 423aa AT1G47270.1 not_not 0.480519480 III
Gm037352 not found in 381aa AT1G53320.1 not_not 0.450216450 III
Gm034540 not found in 378aa AT1G53320.1 not_not 0.448773448 III
Gm048089 not found in 410aa AT1G47270.1 not_not 0.419913419 III
Gm003396 not found in 407aa AT1G25280.1 not_not 0.415584415 III
Pt034249 not found in 395aa AT2G47900.2 not_not 0.588744588 III
Pt000712 not found in 424aa AT1G76900.2 not_not 0.525252525 III
Pt000711 not found in 424aa AT1G76900.2 not_not 0.525252525 III
Pt000710 not found in 424aa AT1G76900.2 not_not 0.525252525 III
Pt000709 not found in 424aa AT1G76900.2 not_not 0.525252525 III
Pt002868 not found in 423aa AT1G25280.1 not_not 0.516594516 III
Pt039357 not found in 424aa AT1G76900.2 not_not 0.507936507 III
Pt037559 not found in 416aa AT2G18280.2 not_not 0.506493506 III
Pt037558 not found in 416aa AT2G18280.2 not_not 0.506493506 III
Pt001281 not found in 414aa AT2G18280.2 not_not 0.500721500 III
Pt037730 not found in 416aa AT1G47270.1 not_not 0.497835497 III
Pt001717 not found in 416aa AT1G47270.1 not_not 0.496392496 III
Pt028965 not found in 377aa AT1G53320.1 not_not 0.431457431 III
Pt025486 not found in 379aa AT1G53320.1 not_not 0.431457431 III
Pp034735 not found in 483aa AT2G47900.2 not_not 0.520923520 III
Pp034734 not found in 483aa AT2G47900.2 not_not 0.520923520 III
Pp034759 not found in 428aa AT2G47900.2 not_not 0.513708513 III
Pp005711 not found in 407aa AT2G47900.2 not_not 0.510822510 III
Pp022942 not found in 447aa AT2G47900.2 not_not 0.510822510 III
Pp022947 not found in 435aa AT2G47900.2 not_not 0.509379509 III
Sm012016 ATSTYHLCLGLSPNFD in 155/430 AT2G47900.2 not_not 0.513708513 III
Sm016835 not found in 432aa AT2G47900.2 not_not 0.499278499 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (1 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT3G06380.1     ------------------------------------------------------------
gm054928_Glyma2 ------------------------------------------------------------
gm003397_Glyma0 ------------------------------------------------------------
pt028965_POPTR_ ------------------------------------------------------------
gm048089_Glyma1 ------------------------------------------------------------
gm041219_Glyma1 ------------------------------------------------------------
pp034759_Pp1s15 ------------------------------------------------------------
gm021743_Glyma0 ------------------------------------------------------------
gm030081_Glyma1 ------------------------------------------------------------
pt001281_POPTR_ ------------------------------------------------------------
Sm016835_Selmo1 ---------------------------------------------MSGKK--------SS
gm039265_Glyma1 ------------------------------------------------------------
Os003208_Os01t0 ------------------------------------------------------------
pp005711_Pp1s21 ------------------------------------------------------------
Sb019095_Sorbi1 ------------------------------------------------------------
gm003133_Glyma0 ------------------------------------------------------------
gm039266_Glyma1 ------------------------------------------------------------
gm044960_Glyma1 ------------------------------------------------------------
Sb027814_Sorbi1 ------------------------------------------------------------
gm044959_Glyma1 ------------------------------------------------------------
pt000710_POPTR_ ------------------------------------------------------------
gm004126_Glyma0 ------------------------------------------------------------
Os009471_Os02t0 ------------------------------------------------------------
pt000712_POPTR_ ------------------------------------------------------------
gm041730_Glyma1 ------------------------------------------------------------
gm045746_Glyma1 ------------------------------------------------------------
gm036752_Glyma1 ------------------------------------------------------------
gm021741_Glyma0 ------------------------------------------------------------
Os019649_Os04t0 ------------------------------------------------------------
pp022947_Pp1s22 ------------------------------------------------------------
pp034735_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRR-------SGS
gm045744_Glyma1 ------------------------------------------------------------
gm001764_Glyma0 ------------------------------------------------------------
pt037558_POPTR_ ------------------------------------------------------------
Os022386_Os05t0 ------------------------------------------------------------
gm045745_Glyma1 ------------------------------------------------------------
pp022942_Pp1s22 ------------------------------------------------------------
Sb028483_Sorbi1 ------------------------------------------------------------
Os009468_Os02t0 ------------------------------------------------------------
pp034734_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRR-------SGS
gm028526_Glyma1 ------------------------------------------------------------
gm054929_Glyma2 ------------------------------------------------------------
gm034540_Glyma1 ------------------------------------------------------------
Os021774_Os05t0 ------------------------------------------------------------
Os029803_Os08t0 ------------------------------------------------------------
Os022387_Os05t0 ------------------------------------------------------------
Os022798_Os05t0 ------------------------------------------------------------
pt039357_POPTR_ ------------------------------------------------------------
gm028527_Glyma1 ------------------------------------------------------------
Os029491_Os07t0 ------------------------------------------------------------
Os021773_Os05t0 ------------------------------------------------------------
gm019438_Glyma0 ------------------------------------------------------------
Os003209_Os01t0 ------------------------------------------------------------
Sb024300_Sorbi1 --AEEC------------------------SCG-GGGGF----WRVGGRE------RQAS
gm030080_Glyma1 ------------------------------------------------------------
gm044675_Glyma1 ------------------------------------------------------------
pt001717_POPTR_ ------------------------------------------------------------
Sm012016_Selmo1 ---------------------------------------------MSGKKS-----SSSS
Os019651_Os04t0 ------------------------------------------------------------
Sb032884_Sorbi1 ---------------------------------------------IFGAVSSPFFFPLSF
gm003395_Glyma0 ------------------------------------------------------------
pt002868_POPTR_ ------------------------------------------------------------
Os040209_Os12t0 ------------------------------------------------------------
pt037730_POPTR_ ------------------------------------------------------------
gm003396_Glyma0 ------------------------------------------------------------
gm037352_Glyma1 ------------------------------------------------------------
Sb025595_Sorbi1 ------------------------------------------------------------
pt037559_POPTR_ ------------------------------------------------------------
pt025486_POPTR_ ------------------------------------------------------------
pt000711_POPTR_ ------------------------------------------------------------
pt034249_POPTR_ ------------------------------------------------------------
gm021742_Glyma0 ------------------------------------------------------------
pt000709_POPTR_ ------------------------------------------------------------
Os004869_Os01t0 ------------------------------------------------------------
gm021740_Glyma0 ------------------------------------------------------------
                                                                            

AT3G06380.1     --MTF----------------------------------RSLLQE---------------
gm054928_Glyma2 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
gm003397_Glyma0 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
pt028965_POPTR_ --MSL----------------------------------RRSFLS-RRFSRSFNNQNRNE
gm048089_Glyma1 --MPF----------------------------------RSIVRELKEIGEGISNMYRR-
gm041219_Glyma1 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
pp034759_Pp1s15 --MPL----------------------------------KSLIREFQEMKGGRGGISRR-
gm021743_Glyma0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
gm030081_Glyma1 --MSL----------------------------------KSIVRELKEMRDGIGSMSRR-
pt001281_POPTR_ --MSF----------------------------------KSIMREFKEIKEGIGSISRR-
Sm016835_Selmo1 TLTPL----------------------------------WSVIQD---IK-GIGSISRR-
gm039265_Glyma1 --MPF----------------------------------RSIVRELKEIGEGISNMYRR-
Os003208_Os01t0 ----------------------------------------------------MPRETPP-
pp005711_Pp1s21 ------------------------------------------------MKSGVGRISRR-
Sb019095_Sorbi1 ----------------------------------------------------MAAPLVP-
gm003133_Glyma0 --MSL----------------------------------RSIVRELKEMRDGIGSTSKR-
gm039266_Glyma1 --MPF----------------------------------RSIVRELKEIGEGISNMYRR-
gm044960_Glyma1 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
Sb027814_Sorbi1 AAMSL----------------------------------KSIVRELKEMRDGIGSMSRRG
gm044959_Glyma1 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
pt000710_POPTR_ --MSF----------------------------------RSIVRD---MRDGFGSLSRR-
gm004126_Glyma0 --MSF----------------------------------RSIILE------------RK-
Os009471_Os02t0 ------------------------------------------------MRDGIGSMSRR-
pt000712_POPTR_ --MSF----------------------------------RSIVRD---MRDGFGSLSRR-
gm041730_Glyma1 -MCLI----------------------------------RSM------------------
gm045746_Glyma1 ------------------------------------------------------------
gm036752_Glyma1 ------------------------------------------------------------
gm021741_Glyma0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
Os019649_Os04t0 --MSF----------------------------------RSIVRD---FRDSFGTLSKR-
pp022947_Pp1s22 ------------------------------------------------MKGGIGNISRR-
pp034735_Pp1s15 SMMPL----------------------------------KSLIREFQEMKGGRGGISRR-
gm045744_Glyma1 ------------------------------------------------------------
gm001764_Glyma0 --MSL----------------------------------KSIVRELKEMRDGIGSMSRR-
pt037558_POPTR_ --MSI----------------------------------KSIVRELKEMKDGIGNISRR-
Os022386_Os05t0 -----------------------------------------MALW-RCSSSWLSSVSRSS
gm045745_Glyma1 ------------------------------------------------------------
pp022942_Pp1s22 --MPL----------------------------------KSLIREFQEMKGGIGNISRR-
Sb028483_Sorbi1 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
Os009468_Os02t0 --MSL----------------------------------KSIVRELREMRDGIGSMSRR-
pp034734_Pp1s15 SMMPL----------------------------------KSLIREFQEMKGGRGGISRR-
gm028526_Glyma1 --MSF----------------------------------RSIVRE---VRDGFGSLSRR-
gm054929_Glyma2 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
gm034540_Glyma1 --MSL----------------------------------RKVFRS-RKFSKSFKEVLPAE
Os021774_Os05t0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
Os029803_Os08t0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
Os022387_Os05t0 -----------------------------------------MALW-RCSSSWLSSVSRSS
Os022798_Os05t0 ----------------------------------------------------MAAVREP-
pt039357_POPTR_ --MSF----------------------------------RSIVRD---MRDGFGSLSRR-
gm028527_Glyma1 --MSF----------------------------------RSIVRE---VRDGFGSLSRR-
Os029491_Os07t0 --MSF----------------------------------RSVIQE---VKGEIGAISRR-
Os021773_Os05t0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
gm019438_Glyma0 ------------------------------------------------------------
Os003209_Os01t0 ----------------------------------------------------MPRETPP-
Sb024300_Sorbi1 GDMPF----------------------------------SSMIHE---MKGEIGAISSR-
gm030080_Glyma1 --MSL----------------------------------KSIVRELKEMRDGIGSMSRR-
gm044675_Glyma1 --MSL----------------------------------RSIVRELKEMRDGIGSTSKR-
pt001717_POPTR_ --MSF----------------------------------KS---KLKEIRDDITTTFSMG
Sm012016_Selmo1 SLLPL----------------------------------RSILREFQDIRDGIGSLSRR-
Os019651_Os04t0 --MSF----------------------------------RSIVRD---FRDSFGTLSKR-
Sb032884_Sorbi1 SFLSLASLPCSLPPPAPFIPPSARANLFRGRAGIGARRPPVMISW-RRSASWLSSASRSS
gm003395_Glyma0 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
pt002868_POPTR_ --MSF----------------------------------RSIVRD---MRDGFGSLSRR-
Os040209_Os12t0 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
pt037730_POPTR_ --MSF----------------------------------KG---KLKEIRDDISTTFSMG
gm003396_Glyma0 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
gm037352_Glyma1 --MSL----------------------------------RKVFRS-RKFSRSFKEVLPAE
Sb025595_Sorbi1 ---------------------------VHKRAKKEEEREKRKGEA-RDCSGEMSRHAAPA
pt037559_POPTR_ --MSI----------------------------------KSIVRELKEMKDGIGNISRR-
pt025486_POPTR_ --MSL----------------------------------RRSILS-RRFSRSFNNQNRNE
pt000711_POPTR_ --MSF----------------------------------RSIVRD---MRDGFGSLSRR-
pt034249_POPTR_ -MPAL----------------------------------KSII-----------------
gm021742_Glyma0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
pt000709_POPTR_ --MSF----------------------------------RSIVRD---MRDGFGSLSRR-
Os004869_Os01t0 --MSF----------------------------------RSIVRD---VRDGFGSLSRR-
gm021740_Glyma0 --MSF----------------------------------RSIVRD---VRDSFGSLSRR-
                                                                            

AT3G06380.1     --------------------MRSRPHRVVHAAASTAN-------------SSDPFSWSEL
gm054928_Glyma2 -----SFEVR------LPGHNRGKSRSSVHELQDQPP-------------VIQNSRWASL
gm003397_Glyma0 -----SFDVR------ISGG--GKLNSLVHEAHERQL-------------VIQNSRWASL
pt028965_POPTR_ RNGV----------------ESGRLVG-----E----------------SGGESDGWGSM
gm048089_Glyma1 -----GGEAK-------HVHRHGKS-HIAPECSLPPPPSSSSSSSSSS---SWQSRWANL
gm041219_Glyma1 -----SFDVR------LTGHHRGKSQGSVQDLHDQPL-------------VIQNSRWASL
pp034759_Pp1s15 -----SFELK------FPHHHKGRSSGMVLDESQLRVEAV-----------VKQSCWANM
gm021743_Glyma0 -----SFDVR------LTGHHRGKSQGSVQDLHDQPL-------------VIQNSRWASL
gm030081_Glyma1 -----GVESR-------RWNGRTKS-HVAPDVTLTSLEPIQQGH------------WANL
pt001281_POPTR_ -----GVEGK-------HWCGRVRS-HIAPDETREETDQIDQGQ------------WANL
Sm016835_Selmo1 -----SFEVK------LPTYSRSRSHSAAQDAAGRHQFGE----------SGQQSRWANM
gm039265_Glyma1 -----GGEAK-------HVHRHGKS-HIAPECSLPPPPPPPPSSSS-------QSRWANL
Os003208_Os01t0 ---------------PPP-PEGGEVHEV-VEGE-------------DGQAEDQEERWARL
pp005711_Pp1s21 -----SFELK------FPHHHRGRSSGMVLDESQLNSEPV-----------VEQSCWANM
Sb019095_Sorbi1 -------------------REEGLRQEGAVEQE-------------------EEDRWACL
gm003133_Glyma0 -----GAESK-------HRLSRTKS-HVAPDVLATPFEPIQQGQ------------WANL
gm039266_Glyma1 -----GGEAK-------HVHRHGKS-HIAPECSLPPPPPPPPSSSS-------QSRWANL
gm044960_Glyma1 -----SFDVR------LSGG--GKSNSLVHEEHECLP-------------VVQNSRWASL
Sb027814_Sorbi1 G---SGSDGR-------AGHGRSGSRHSWPSLWAEQQQPQRQGQEGPQHQHQHQGRWANL
gm044959_Glyma1 -----SFDVR------LSGG--GKSNSLVHEEHECLP-------------VVQNSRWASL
pt000710_POPTR_ -----SFEVR------LPGHFRGKSHGSACELLDQPV-------------VIQDSPWAGL
gm004126_Glyma0 -----GFEVK------FGYSMRSRSQSHSDAIAQDSL---------VVLDGLKQSCWANM
Os009471_Os02t0 -----AADGR-------AGGGRGGSRHSWPVLWSEQQQPPQQQQLQRQEHQQQQGRWANL
pt000712_POPTR_ -----SFEVR------LPGHFRGKSHGSACELLDQPV-------------VIQDSPWAGL
gm041730_Glyma1 -----------------------RSQSQR--VVQEQEEAE------CVGDSMRQSCWANM
gm045746_Glyma1 ------------------------------------------MI-EVQANAMEQSWWANM
gm036752_Glyma1 ------------------------------------------------------------
gm021741_Glyma0 -----SFDVR------LTGHHRGKSQGSVQDLHDQPL-------------VIQNSRWASL
Os019649_Os04t0 -----SFEVKIS---GFSGRHRGKSIGPSSELDDTPV-------------VAQQSKWAGL
pp022947_Pp1s22 -----SFELK------FPHHHKGRSSGMVLDESQLRAEPV-----------VEQSCWANM
pp034735_Pp1s15 -----SFELK------FPHHHKGRSSGMVLDESQLRVEAV-----------VKQSCWANM
gm045744_Glyma1 ------------------------------------------MI-EVQANAMEQSWWANM
gm001764_Glyma0 -----GVESR-------RWNGRTKS-HVAPDVILTSLEPIQQGQ------------WANL
pt037558_POPTR_ -----GLEGK-------HWRGRARS-HIAPDETPAETDQIEQGQ------------WANL
Os022386_Os05t0 -GGVGGGESK---VSPEIAPVSGGEGEG--EEE-----------------EGEEERWSRL
gm045745_Glyma1 ------------------------------------------MI-EVQANAMEQSWWANM
pp022942_Pp1s22 -----SFELK------FPHHHKGRSSGMVLDESQLRAEPV-----------VEQSCWANM
Sb028483_Sorbi1 -----GFEVR------FLSPRRGKSHGAVHELHDPVP-------------VVQSSCWASL
Os009468_Os02t0 -----AADGR-------AGGGRGGSRHSWPVLWSEQQQPPQQQQLQRQEHQQQQGRWANL
pp034734_Pp1s15 -----SFELK------FPHHHKGRSSGMVLDESQLRVEAV-----------VKQSCWANM
gm028526_Glyma1 -----SFEVR------LPGHNRGKSRSLVHELQDQPP-------------VIQNSRWASL
gm054929_Glyma2 -----SFEVR------LPGHNRGKSRSSVHELQDQPP-------------VIQNSRWASL
gm034540_Glyma1 GAAV----------------EGGVAGTV--EEA----------------ANGNNNGWSSM
Os021774_Os05t0 -----SFEVTLAGLSGLTGHHRGKSQSTVHELCDADL-------------IIQESRWASL
Os029803_Os08t0 -----SFEVRISGLPGLSGHHRGKSLGSLSELRDRPV-------------VVDQSRWVGL
Os022387_Os05t0 -GGVGGGESK---VSPEIAPVSGGEGEG--EEE-----------------EGEEERWSRL
Os022798_Os05t0 -------------------REEAAVGEG--EGE-------------------EEGRWGGL
pt039357_POPTR_ -----SFEVR------LPGHLRGKSHGSACELQDQPV-------------VIQNSRWAGL
gm028527_Glyma1 -----SFEVR------LPGHNRGKSRSLVHELQDQPP-------------VIQNSRWASL
Os029491_Os07t0 -----GF--------------RSRPGRVR-RVAAAAEEPP-DES-SAAALVMRESCWTQL
Os021773_Os05t0 -----SFEVTLAGLSGLTGHHRGKSQSTVHELCDADL-------------IIQESRWASL
gm019438_Glyma0 ---------------------------------------------------MEQSWRANM
Os003209_Os01t0 ---------------PPP-PEGGEVHEV-VEGE-------------DGQAEDQEERWARL
Sb024300_Sorbi1 -----GL-------------LRFRSGGHAAAAGRASAAAEPDE-------ALRESCWARV
gm030080_Glyma1 -----GVESR-------RWNGRTKS-HVAPDVTLTSLEPIQQGH------------WANL
gm044675_Glyma1 -----GAESK-------HWLSRTKS-HVAPDILATPFEPIQQGQ------------WANL
pt001717_POPTR_ -----KLQRN-------RTNRRGRA-YIAPEL--------GGGSELLSELIEEQSPWANL
Sm012016_Selmo1 -----SFEVR------LPYHHRSRSHSVVLDEPPVRDVVV-----------LQQSRWASM
Os019651_Os04t0 -----SFEVKIS---GFSGRHRGKSIGPSSELDDTPV-------------VAQQSKWAGL
Sb032884_Sorbi1 LGAAVGGEAK---VTPEVDPAAAQEME---EDE-----------------EADEERWSRL
gm003395_Glyma0 -----SFDVR------ISGG--GKLNSLVHEAHERQL-------------VIQNSRWASL
pt002868_POPTR_ -----SFEVR------LPGHHRGKSHSSACELHDQPV-------------VIQNSRWAGL
Os040209_Os12t0 -----GFEVR------LVGHRRGRSHSAVHELRDGHAAAA-------AADVVQSSCWANL
pt037730_POPTR_ -----KLQRN-------RTNRRGRA-YIAPEL--------GGGSELFRELIEEQSPWANL
gm003396_Glyma0 -----SFDVR------ISGG--GKLNSLVHEAHERQL-------------VIQNSRWASL
gm037352_Glyma1 GAAIVG-------------GEDGVAGAG--EES----------------SNG-NNGWSNM
Sb025595_Sorbi1 --------------APPPLPERGEMDEV-VEADP------------DAEAEDQEERWARL
pt037559_POPTR_ -----GLEGK-------HWRGRARS-HIAPDETPAETDQIEQGQ------------WANL
pt025486_POPTR_ RNAV----------------ESGRLGG-----E----------------LWAESDGWGSM
pt000711_POPTR_ -----SFEVR------LPGHFRGKSHGSACELLDQPV-------------VIQDSPWAGL
pt034249_POPTR_ ----------------------NRSTSHR--VVQYSSAPELNLF-AAGGAAETASCWANL
gm021742_Glyma0 -----SFDVR------LTGHHRGKSQGSVQDLHDQPL-------------VIQNSRWASL
pt000709_POPTR_ -----SFEVR------LPGHFRGKSHGSACELLDQPV-------------VIQDSPWAGL
Os004869_Os01t0 -----SFEVTLASLYGLTGHHKGKTQSSLDELDDSPA-------------IIPESRWASL
gm021740_Glyma0 -----SFDVR------LTGHHRGKSQGSVQDLHDQPL-------------VIQNSRWASL
                                                                            

AT3G06380.1     PEELLREILIRVET-VDGGDWPSRRNVVACAGVCRSW-RILTKEIVA-VPEFS-------
gm054928_Glyma2 PPELLRDVINRLEA-SEST-WPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC-------
gm003397_Glyma0 PPELLCDVIKRLEE-SEST-WPARKHVVACAAVCKSW-REMCKEIVT-SPEFC-------
pt028965_POPTR_ LPELLGEIIKRVEE-SEDR-WPQRQNVVACACVCKKW-REVTKDIVKSLPNNNN--NNGS
gm048089_Glyma1 PPELLLDIIQRLEA-SETS-WPARRALVACASVCKLW-REITKDVVK-TPEQC-------
gm041219_Glyma1 PPELLFDIIRRLEE-SENT-WPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC-------
pp034759_Pp1s15 PPELLRDVIQRVEA-SESA-WPGRKHVVACAAVCSSW-REITKELVR-TPEQS-------
gm021743_Glyma0 PPELLFDIIRRLEE-SENT-WPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC-------
gm030081_Glyma1 PPELLLDIIRRVED-SETT-WPARAVVVYCGSVCKSW-RAVTKEIVK-TPEQC-------
pt001281_POPTR_ PPELLLDIIMRLEE-SESS-WPARVVVVHCASVCRSW-REITKEIVK-TPEQC-------
Sm016835_Selmo1 PPELLRDVIQRVEA-SDKM-WPSRKSVVACAAVCRNW-RKITKEIVQ-TLEQC-------
gm039265_Glyma1 PPELLLDIIQRLEA-SETS-WPARRALVACASVCRLW-REITKDVIK-TPEQC-------
Os003208_Os01t0 LPELMSEVVRRVEASGGER-WPARKDVVSCACVCRRW-RDAAVAVVR-PPAES-------
pp005711_Pp1s21 PPELLRDVIQRVEA-SESA-WPSRKHVVACAAVCSSW-REVTKELVR-APEQS-------
Sb019095_Sorbi1 LPELLAEVLRRLEASGGER-WPARKDVVSCACVCRRW-RDVAATVVR-PLPES-------
gm003133_Glyma0 PSELLLDIIQRVEE-SETS-WPARAVVVFCASVCKSW-RSITREIVK-TPEQC-------
gm039266_Glyma1 PPELLLDIIQRLEA-SETS-WPARRALVACASVCRLW-REITKDVIK-TPEQC-------
gm044960_Glyma1 PPELLRDVIKRLEE-SETT-WPARKHVVACAAVCRSW-RGMCKEIVT-SPEFC-------
Sb027814_Sorbi1 PPELLLDVIQRVES-SEAT-WPARRQVVACAAVCRSW-REVTKEVVK-TLEEC-------
gm044959_Glyma1 PPELLRDVIKRLEE-SETT-WPARKHVVACAAVCRSW-RGMCKEIVT-SPEFC-------
pt000710_POPTR_ PPELLRDVIKRLEA-SEST-WPARKHVVACASVCRAW-REMCKEIVR-SPEFS-------
gm004126_Glyma0 PPELLRDVLMRIEA-SEDS-WPAQKHVVACAGVCRSW-REIMKEIVK-SPQLS-------
Os009471_Os02t0 PPELLLDVIQRVEA-SEAT-WPARRQVVACAAVCRSW-REVTKEVVK-TLEEC-------
pt000712_POPTR_ PPELLRDVIKRLEA-SEST-WPARKHVVACASVCRAW-REMCKEIVR-SPEFS-------
gm041730_Glyma1 PQELLREVLFRIEA-SEDA-WPPRKSVVACAGVCRSW-RQITIDIVK-TPELS-------
gm045746_Glyma1 PHELLREVLLRIES-SEST-WPLRRSVVACGGVCRTWRRLIVKEIVK-PPQFS-------
gm036752_Glyma1 ------------------------------------------------------------
gm021741_Glyma0 PPELLFDIIRRLEE-SENT-WPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC-------
Os019649_Os04t0 PPELLRDVMKRLEE-DDSN-WPSRKDVVACASVCTTW-RDMCKDIVR-NPEFC-------
pp022947_Pp1s22 PPELLRDVIQRVEA-SENA-WPSRKHVVACAAVCSSW-REITKELVR-TPEQS-------
pp034735_Pp1s15 PPELLRDVIQRVEA-SESA-WPGRKHVVACAAVCSSW-REITKELVR-TPEQS-------
gm045744_Glyma1 PHELLREVLLRIES-SEST-WPLRRSVVACGGVCRTWRRLIVKEIVK-PPQFS-------
gm001764_Glyma0 PPELLLDIIRRVED-SETT-WPARAVVVYCGSVCKSW-RAVTKEIVK-TPEQC-------
pt037558_POPTR_ PPELLLDIIRRVEE-SETS-WPARAVVVHCASVCRSW-REITKEIVK-TPEQC-------
Os022386_Os05t0 LPELLTEIMRRVDA-GAER-WPPRRDVVACACVCRRW-RDAAVSVVR-PPLEC-------
gm045745_Glyma1 PHELLREVLLRIES-SEST-WPLRRSVVACGGVCRTWRRLIVKEIVK-PPQFS-------
pp022942_Pp1s22 PPELLRDVIQRVEA-SENA-WPSRKHVVACAAVCSSW-REITKELVR-TPEQS-------
Sb028483_Sorbi1 PPELLRDVIERLET-SEDT-WPSRKHVVACAAVCRTW-REMCREIVK-SPEVS-------
Os009468_Os02t0 PPELLLDVIQRVEA-SEAT-WPARRQVVACAAVCRSW-REVTKEVVK-TLEEC-------
pp034734_Pp1s15 PPELLRDVIQRVEA-SESA-WPGRKHVVACAAVCSSW-REITKELVR-TPEQS-------
gm028526_Glyma1 PPELLRDVINRLEA-SEST-WPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC-------
gm054929_Glyma2 PPELLRDVINRLEA-SEST-WPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC-------
gm034540_Glyma1 LPEILGEIVRRVDA-AEEQ-WPNRQNVVACACVCKRW-RDITREVVR-VPSHT-------
Os021774_Os05t0 PPELLRDVIRRLEA-SEST-WPSRKDVVSCAAVCKAW-REMCKEIVL-SPEFC-------
Os029803_Os08t0 PPELLRDVMKRLEE-GESN-WPSRKDVVACAAVCRTW-REICKDIVQ-SPEIC-------
Os022387_Os05t0 LPELLTEIMRRVDA-GAER-WPPRRDVVACACVCRRW-RDAAVSVVR-PPLEC-------
Os022798_Os05t0 LPELVEEVVRRVEASGGER-WPARKDLVSCACVCRRW-REAAAAVVR-PLPES-------
pt039357_POPTR_ PPELLQDVIKRLEA-SEST-WPSRKHVVACASVCRAW-REMCKEIVR-SPEFS-------
gm028527_Glyma1 PPELLRDVINRLEA-SEST-WPGRKHVVACAAVCKSW-REMCKEIVS-SPEFC-------
Os029491_Os07t0 PPELLREVLARVEE-SEGW-WPRRRDVVACAGVCRSW-RGIVREIVR-TPEAS-------
Os021773_Os05t0 PPELLRDVIRRLEA-SEST-WPSRKDVVSCAAVCKAW-REMCKEIVL-SPEFC-------
gm019438_Glyma0 PRELLREVLLRIES-SEAT-WPSRRSVVACGGVCRTW-RLIVKEIVK-PPQLS-------
Os003209_Os01t0 LPELMSEVVRRVEASGGER-WPARKDVVSCACVCRRW-RDAAVAVVR-PPAES-------
Sb024300_Sorbi1 PPELLRMVLARVEH-EEAR-WPGRSAVVASAGVCRCW-RAVVKEMVR-VPEVS-------
gm030080_Glyma1 PPELLLDIIRRVED-SETT-WPARAVVVYCGSVCKSW-RAVTKEIVK-TPEQC-------
gm044675_Glyma1 PSELLLDIIQRIEE-SETS-WPARAVVVFCASVCKSW-RSITREIVK-TPEQC-------
pt001717_POPTR_ PPELLQDVIKRVEG-SETS-WPGRRDVVACASVCTSW-REITKAVVK-TPEQC-------
Sm012016_Selmo1 PPELLRDVIQRLES-SEHT-WPARKNVVVCAEVCSQW-RDIAKELVK-TPEQS-------
Os019651_Os04t0 PPELLRDVMKRLEE-DDSN-WPSRKDVVACASVCTTW-RDMCKDIVR-NPEFC-------
Sb032884_Sorbi1 LPELLTEIMRRVDA-GAER-WPPRRDVVVCACVCRRW-RDAAVSVVR-PPLEC-------
gm003395_Glyma0 PPELLCDVIKRLEE-SEST-WPARKHVVACAAVCKSW-REMCKEIVT-SPEFC-------
pt002868_POPTR_ PPELLRDVIKRLEA-SEST-WPARKHVVACAAVCSAW-REMCKEIVR-NPEFS-------
Os040209_Os12t0 PPELLRDVIERLEA-SEAA-WPSRKNVVACAAVCRTW-RDMCREIVK-NPEFC-------
pt037730_POPTR_ PPELLHDVIQRVEG-SETS-WPGRRDVVACASVCKSW-REITKTVVK-TPEQC-------
gm003396_Glyma0 PPELLCDVIKRLEE-SEST-WPARKHVVACAAVCKSW-REMCKEIVT-SPEFC-------
gm037352_Glyma1 LPEILGEIVRRVDA-AEEQ-WPNRQNVVACACVCKRW-RDITREVVR-VPSHT-------
Sb025595_Sorbi1 LPELLSDVVQRVEASGGER-WPARKDVVSCACVCRRW-REAAVAVVR-PPAES-------
pt037559_POPTR_ PPELLLDIIRRVEE-SETS-WPARAVVVHCASVCRSW-REITKEIVK-TPEQC-------
pt025486_POPTR_ LPELLGEIIKRVEE-SEDR-WPQRQSVVACACVCKKW-RDVTKDIVKSLPNSSSSTNNAS
pt000711_POPTR_ PPELLRDVIKRLEA-SEST-WPARKHVVACASVCRAW-REMCKEIVR-SPEFS-------
pt034249_POPTR_ PQELLREVLVRIEE-SESS-WPPRKNVVACAGVCRSW-RHITKDLVK-VPELS-------
gm021742_Glyma0 PPELLFDIIRRLEE-SENT-WPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC-------
pt000709_POPTR_ PPELLRDVIKRLEA-SEST-WPARKHVVACASVCRAW-REMCKEIVR-SPEFS-------
Os004869_Os01t0 PPELLREVIRRLEA-DEST-WPSRRNVVCFAAVCRTW-REMCKETVL-SPEFC-------
gm021740_Glyma0 PPELLFDIIRRLEE-SENT-WPARKHVVACAAVCQSW-RNMCKDIVK-SPEFC-------
                                                                            

AT3G06380.1     -SKLTFPISLKQSGPRDSLVQCFIKRNRNTQSYHLYLGLTTS----L----TDNGKFLLA
gm054928_Glyma2 -GKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPA----LL---VENGKFLLS
gm003397_Glyma0 -GKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
pt028965_POPTR_ SGKITFPSCLKQPGPRDLPHQCLIKRNKKTSTFYLYLALTPS----FT----DKGKFLLA
gm048089_Glyma1 -GFITFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPA----LS---GDMSKLLLA
gm041219_Glyma1 -GKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
pp034759_Pp1s15 -GRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPT----L----VENGKFLLA
gm021743_Glyma0 -GKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
gm030081_Glyma1 -GRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-----E---NETDKLLLA
pt001281_POPTR_ -GRLTFPISLKQPGPRESPIQCFIKRDNATSTFLLYYGLVPS-----G---GENDKLLLA
Sm016835_Selmo1 -GRLTFPVSLKQPGPRDATVQCYLKRDRTTSTYYLYLGITPSKPS------KKNGKFLLA
gm039265_Glyma1 -GLLTFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPA----LS---GDMSKLLLA
Os003208_Os01t0 -GKITFPSSLKQPGPREFPMQCFIKRNKKNSTFYLYLGLTNA----TV----DKGKFLMA
pp005711_Pp1s21 -GRLTFPVALKQPGPREDTVQCFIKRDRTTSTYQLFLGLPPS----Q-----ENGKFLLA
Sb019095_Sorbi1 -GKITFLASLKQPGPKDFPIQCFIKRNKKNSLFYLYLGLTNN----PMMPATDKGKFLMA
gm003133_Glyma0 -GRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLYFGLVPS-----E---NDSNKLLLA
gm039266_Glyma1 -GLLTFPISLKQPGPRDSPIQCFIRRERMTSTYCLYLGLSPA----LS---GDMSKLLLA
gm044960_Glyma1 -GKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
Sb027814_Sorbi1 -GRITFPISLKQPGPRDLPVQCFVRRERATSTYLLYLGLSPS----MN---MENDKLLLA
gm044959_Glyma1 -GKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
pt000710_POPTR_ -GKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
gm004126_Glyma0 -GKLTFPISLKQPGPRDSLLQCYIKRNRSNQTYYLFLGLNQA----S----TDEGKFLLS
Os009471_Os02t0 -GRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPS----LH---GENDKLLLA
pt000712_POPTR_ -GKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
gm041730_Glyma1 -SKITFPISVKQPGPRENLLRCFIKRNRSSQTYYLYLSLTNT----L----AEDGKFLLA
gm045746_Glyma1 -SNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSA----LV---ADDGKFLLA
gm036752_Glyma1 -----------MPGPRENLLRCFIKRNRSTQTYYLFLSLTST----L----AEDGKFLLA
gm021741_Glyma0 -GKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
Os019649_Os04t0 -GKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSA----VL---DETGKFLLS
pp022947_Pp1s22 -GRLTFPIALKQPGPRENTVQCFIKRDRTTSTYQLFLGLPPS----L----VENGKFLLA
pp034735_Pp1s15 -GRLTFPIALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPS----L----VENGKFLLA
gm045744_Glyma1 -SNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSA----LV---ADDGKFLLA
gm001764_Glyma0 -GRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-----E---NETDKLLLA
pt037558_POPTR_ -GRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-----E---GENDKLLLA
Os022386_Os05t0 -GRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQA----LT----DKGKFLLA
gm045745_Glyma1 -SNITFPISLKQPGPREHLLQCFIRRNSASQTYYLFLSLSSA----LV---ADDGKFLLA
pp022942_Pp1s22 -GRLTFPIALKQPGPRDSTMQCFIKRDRTTSTYQLFLGLPPS----L----VENGKFLLA
Sb028483_Sorbi1 -GKITFPVSLKQPGPRDGTIQCFIKRDKSTQVYSLYLSFSSA----VP---AEDGKFLLS
Os009468_Os02t0 -GRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPS----LH---GENDKLLLA
pp034734_Pp1s15 -GRLTFPIALKQPGPRESTVQCFIKRDRTSSTYQLYLGLPPS----L----VENGKFLLA
gm028526_Glyma1 -GKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLGLSPA----LL---VENGKFLLS
gm054929_Glyma2 -GKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLCLSPA----LL---VENGKFLLS
gm034540_Glyma1 -GKITFPSCLKQPGPRDVPHQCLIKRNQKTSTFYLYLALTPS----FT----DKGKFLLA
Os021774_Os05t0 -GKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTA----VL---ADSGKFLLS
Os029803_Os08t0 -GKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPA----VL---SENGKFLLA
Os022387_Os05t0 -GRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQA----LT----DKGKFLLA
Os022798_Os05t0 -GRITFPSSLKQPGPKDFPIQCFVKRNKKKSMFYLYLGLLNG----TM----DKGKFLMA
pt039357_POPTR_ -GKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
gm028527_Glyma1 -GKITFPVSLKQPGHRDGPIQCFIKRDKSKLTYHLFLGLSPA----LL---VENGKFLLS
Os029491_Os07t0 -GNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA----L----TDDGKFLLA
Os021773_Os05t0 -GKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTA----VL---ADSGKFLLS
gm019438_Glyma0 -SNITFPISLKQPGPREHLLQCFIRRNSATQTYYLFLSLSSA----LI---ADDGKFLLA
Os003209_Os01t0 -GKITFPSSLKQPGPREFPMQCFIKRNKKNSTFYLYLGLTNA----TV----DKGKFLMA
Sb024300_Sorbi1 -GKITFPISLKQPGPRDAPMKCFIRRNRATQSYSLCIGITDA----L----ADDGKFLLA
gm030080_Glyma1 -GRLTFPISLKQPGPRDSPIQCFIRRNRETSTYLLYIGLVPS-----E---NETDKLLLA
gm044675_Glyma1 -GRITFPISLKQPGPRDSPIQCFIRRNKETSTYLLYFGLVPS-----E---NDGNKLLLA
pt001717_POPTR_ -GCITFPISLKQPGPRDAPIQCFIKRERATSTYHLYLGLSPA----LS---GDMSKLLLA
Sm012016_Selmo1 -GKLTFPISLKQPGPRDATMQCFIKRDRATSTYHLCLGLSPNFDAGL----QEHGKFLLA
Os019651_Os04t0 -GKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSA----VL---DETGKFLLS
Sb032884_Sorbi1 -GRITFPSSLKQPGPRDAPMHCFIRRDKKNSTFSLYLSLTQA----LT----DKGKFLLA
gm003395_Glyma0 -GKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
pt002868_POPTR_ -GKITFPVSLKQPGPRDGTIQCFIKRDKSKLTYHLFLCLSPA----LL---VENGKFLLS
Os040209_Os12t0 -GKITFPVSLKQPGPRNGAIQCFIKRDKSTQTYNLYLCLSSA----VL---VESGKFLLS
pt037730_POPTR_ -GCITFPISLKQPGPRDAPIQCFIKRERATSTYLLYLGLSPA----LS---GDMNKVLLA
gm003396_Glyma0 -GKITFPVSLKQPGSRDGTIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
gm037352_Glyma1 -GKITFPACLKQPGPRDVPHQCLIKRNKKTSTFYLYLALTPS----FT----DKGKFLLA
Sb025595_Sorbi1 -GKITFPSSLKQPGPRESPMQCFIKRNKKNSTFYLYLGFTSS----PV----DKGKFLMA
pt037559_POPTR_ -GRLTFPISLKQPGHRESPIQCFIKRDTATSTFLLYYGLVPS-----E---GENDKLLLA
pt025486_POPTR_ PGKITFPSCLKQPGPRDLPHQCLIKRNKKTSTFYLYLALTPS----FM----DKGKFLLA
pt000711_POPTR_ -GKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
pt034249_POPTR_ -GKITFPISVKQPGPREQLLQCFIKRCRSTQTYRLYLSLNNA----L----TEDGKFLLA
gm021742_Glyma0 -GKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
pt000709_POPTR_ -GKITFPVSLKQPGPRDGTVQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
Os004869_Os01t0 -GKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNV----VT---AEGGKFVLA
gm021740_Glyma0 -GKLTFPVSLKQPGPRDGIIQCFIKRDKSNLTYHLFLCLSPA----LL---VENGKFLLS
                            .* ::   :* : *   .  : *   :             . .*.:::

AT3G06380.1     ASKLKRATCTDYIISLRSDDISKRS--NAYLGRM--------------------------
gm054928_Glyma2 AKRTRRTTCTEYIISMDADNISRSS--STYIGKL--------------------------
gm003397_Glyma0 AKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------------
pt028965_POPTR_ ARRYRQGVHTEYIISLDADDLSQGS--NAYVGKL--------------------------
gm048089_Glyma1 AKKIRRATCTEFIISLVSDDFSWAS--NTYVGKL--------------------------
gm041219_Glyma1 AKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------------
pp034759_Pp1s15 AKKFRRPTRTDYIISLNHDDMSRGG--TAYVGKL--------------------------
gm021743_Glyma0 AKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------------
gm030081_Glyma1 AKKVRRATGTDFIISLVADDFSRSS--NTYVGKL--------------------------
pt001281_POPTR_ ARKIRRATCTDFIVSLVSDDFSRAS--NTYVGKL--------------------------
Sm016835_Selmo1 ARKFRRASGTDYIISTDTDDFSRGS--NTYVGKL--------------------------
gm039265_Glyma1 AKKIRRATCTEFIISLVADDFSRAC--DTYVGKL--------------------------
Os003208_Os01t0 ARRFRRGPHTEYIVSLDADDLSQGS--NAYMGKL--------------------------
pp005711_Pp1s21 AQKFRRATSTDYIISLNQEDMSRGS--STYVGKL--------------------------
Sb019095_Sorbi1 AKRFRRGAPTEYIISLDADDISQGN--KAYVGKL--------------------------
gm003133_Glyma0 AKRIRRATGTGFVISLAADDFSRAS--NKYVGKL--------------------------
gm039266_Glyma1 AKKIRRATCTEFIISLVADDFSRAC--DTYVGKL--------------------------
gm044960_Glyma1 AKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------------
Sb027814_Sorbi1 ARKVRRATRTSFVISLVSDDFSHSS--STYVGKL--------------------------
gm044959_Glyma1 AKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------------
pt000710_POPTR_ AKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------------
gm004126_Glyma0 ARKCRRATHTDYIISLNCDDVSRGS--STYIGKL--------------------------
Os009471_Os02t0 ARKIRRATRTSFVISLVSNDFSLSS--STYVGKL--------------------------
pt000712_POPTR_ AKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------------
gm041730_Glyma1 ARKCRRPTCTDYIISLDADDMSKGS--NSYVGKL--------------------------
gm045746_Glyma1 ARKFRRPTCTDYIISLDADDMSRES--NAYVGKL--------------------------
gm036752_Glyma1 ARKCRRPTCTDYIISLDADDMSKGS--NSYVGKL--------------------------
gm021741_Glyma0 AKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------------
Os019649_Os04t0 AKRSRRTTHTDYIISMDSKNISRSS--SGYIGKL--------------------------
pp022947_Pp1s22 ARKFRRATSTDYIISLNQENMSRGS--NTYVGKL--------------------------
pp034735_Pp1s15 ARKFRRAASTDYIISLNQEDISRGS--NTYVGKL--------------------------
gm045744_Glyma1 ARKFRRPTCTDYIISLDADDMSRES--NAYVGKLRSTLNQILLLAILLFLFLSAKTNPLS
gm001764_Glyma0 AKKVRRATGTDFVISLVADDFFRSS--NTYVGKL--------------------------
pt037558_POPTR_ ARKIRRATCSDFIVSLVSDDFSRAS--NTYVGKL--------------------------
Os022386_Os05t0 ARRFRNGAHTEYIISYDCDDLFPGS--NSYVGKL--------------------------
gm045745_Glyma1 ARKFRRPTCTDYIISLDADDMSRES--NAYVGKL--------------------------
pp022942_Pp1s22 ARKCRRATSTDYIVSLNHEDMSRGS--NTYVGKL--------------------------
Sb028483_Sorbi1 AKRNCRPTYTEYTISINSGDISRSTSNNTYIGKL--------------------------
Os009468_Os02t0 ARKIRRATRTSFVISLVSNDFSLSS--STYVGKL--------------------------
pp034734_Pp1s15 ARKFRRAASTDYIISLNQEDISRGS--NTYVGKL--------------------------
gm028526_Glyma1 AKRTRRTTCTEYVISMDADNISRSS--STYIGKL--------------------------
gm054929_Glyma2 AKRTRRTTCTEYIISMDADNISRSS--STYIGKL--------------------------
gm034540_Glyma1 ARRYRCGTHTEYIISLDADDLSQGS--NAYVGKL--------------------------
Os021774_Os05t0 AKRHRKTTCTEYVISMDADNISRSS--STYIGKL--------------------------
Os029803_Os08t0 AKRNRRATSTEYIISVDSKNISRSS--NGYVGKM--------------------------
Os022387_Os05t0 ARRFRNGAHTEYIISYDCDDLFPGS--NSYVGKL--------------------------
Os022798_Os05t0 ARRFRRGPHTEYVISLDADDLSQGS--NAYVGKL--------------------------
pt039357_POPTR_ AKRKRRTACTEYVISMDADNVSRSS--STYIGKL--------------------------
gm028527_Glyma1 AKRTRRTTCTEYVISMDADNISRSS--STYIGKL--------------------------
Os029491_Os07t0 ARKCRRTTCTEYLISLDMNDISKRT--DSYVGKL--------------------------
Os021773_Os05t0 AKRHRKTTCTEYVISMDADNISRSS--STYIGKL--------------------------
gm019438_Glyma0 ARKFRRPTCIDYIISLDADDMSRES--NAYVGKL--------------------------
Os003209_Os01t0 ARRFRRGPHTEYIVSLDADDLSQGS--NAYMGKL--------------------------
Sb024300_Sorbi1 ARRSRRPAGTEYLISLDAKNTSKG----TCIGKL--------------------------
gm030080_Glyma1 AKKVRRATGTDFIISLVADDFSRSS--NTYVGKL--------------------------
gm044675_Glyma1 AKRIRRATGTDFIISLAADDFSRAS--NKYVGKL--------------------------
pt001717_POPTR_ AKKIRKATSTDFRISFVGSDFCQTS--NTYAGKL--------------------------
Sm012016_Selmo1 ARKVRRATTTDYIISLDPEDFSRGS--TSYVGKL--------------------------
Os019651_Os04t0 AKRSRRTTHTDYIISMDSKNISRSS--SGYIGKL--------------------------
Sb032884_Sorbi1 ARRFRQGAHTEYIISYDYDDLHPRS--SSYVGKL--------------------------
gm003395_Glyma0 AKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------------
pt002868_POPTR_ AKRTRRTTCTEYVISMDADNISRSS--STYIGKL--------------------------
Os040209_Os12t0 AKRYSRATCTEYTIFMSADNTSRSS--NMYIGKL--------------------------
pt037730_POPTR_ AKKIRKATSTDFRISFAGSDFCQTS--NTYVGKL--------------------------
gm003396_Glyma0 AKRTRRTTCTEYIISMDADNISRSN--STYIGKL--------------------------
gm037352_Glyma1 ARRYRCGTHTEYIISLDADDLSQGS--NAYVGKL--------------------------
Sb025595_Sorbi1 ARRFRRGPHTEYIISLDSEDLSQGS--NAYMGKL--------------------------
pt037559_POPTR_ ARKIRRATCSDFIVSLVSDDFSRAS--NTYVGKL--------------------------
pt025486_POPTR_ ARRYRQGAHTEYIISLDADELSQGS--NAYVGKL--------------------------
pt000711_POPTR_ AKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------------
pt034249_POPTR_ ARKCRRPTCTDYIISLDTDDMSKGS--NTYAGKL--------------------------
gm021742_Glyma0 AKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------------
pt000709_POPTR_ AKRSRRTTCTEYVISMDADNISKSS--STYIGKL--------------------------
Os004869_Os01t0 AKRHRKTTCTEYTISMVSGNISRSS--RTNIGKL--------------------------
gm021740_Glyma0 AKRTRRTTYTEYVISMDADNISRSS--NTYIGKL--------------------------
                * :        : :     :           *::                          

AT3G06380.1     ----RSNFLGTKFTVFD------GSQTGAAKM-Q------KSRS-SNFIK-VS--P-RV-
gm054928_Glyma2 ----RSNFLGTKFIIYDTQPPYHNAMLSPPG---------RSRR-F-SKK-VS--P-KV-
gm003397_Glyma0 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---------RSRR-FYSKK-VS--P-KV-
pt028965_POPTR_ ----SSDFLGTNFTIYDSQPPHSGAKPSSS---R------ASRR-FASKQ-IS--P-QV-
gm048089_Glyma1 ----RSNFLGTKFTILDGEPAHETSLPL--NC-K------LQQR-VHLKQ-VL--PNKVA
gm041219_Glyma1 ----RSNFLGTKFIIYDTQPPYSSAHICPPGTGK------TSRR-FYSKK-VS--P-KV-
pp034759_Pp1s15 ----RSNFLGTKFTIYDSQPSHNGVAASN----R------GAWR-MGTKQ-LS--S-RV-
gm021743_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGK------TSRR-FYSKK-VS--P-KV-
gm030081_Glyma1 ----RSNFLGTKFTIYDSQPPHGAAIQP--DS-Q------PSRR-FHSKQ-VS--P-RV-
pt001281_POPTR_ ----RSNFLGTKFTMYDSEPTFEVPRQL--AS-R------TSRR-FNPRQ-VS--L-RL-
Sm016835_Selmo1 ----RSNFMGTKFTLYDSNPPHDGAVASTN---R------AGRR-ILSKQ-VS--P-RV-
gm039265_Glyma1 ----RSNFLGTKFTILDGEPPHDSSLPL--NC-K------LQQR-VHLKQ-VL--PNKV-
Os003208_Os01t0 ----RSDFWGTNFKIYDSKPPYDGAKASSS---R------SSRR-FGSRR-IS--P-QV-
pp005711_Pp1s21 ----RSNFLGTKFTIYDSQPPQNGPVLSN----R------SSRR-LTSKQ-LS--Y-RA-
Sb019095_Sorbi1 ----RSDFLGTNFKIYDSQPPYDGAKASST---R------SIRR-FGSRR-IS--P-QV-
gm003133_Glyma0 ----RSNFLGTKFTVYDSQAPHDSAIQS--NC-Q------SSRR-FHSKQ-VS--P-RV-
gm039266_Glyma1 ----RSNFLGTKFTILDGEPPHDSSLPL--NC-K------LQQR-VHLKQ-VL--PNKV-
gm044960_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---------RSRR-FYSKK-VS--P-KV-
Sb027814_Sorbi1 ----KPNFLGTKFTIFDSQPPPDAVVLP--NN-K------PSKR--QSKQ-VS--P-RL-
gm044959_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---------RSRR-FYSKK-VS--P-KV-
pt000710_POPTR_ ----RSNFLGTKFIIYDTQPPYNNAQLAPPG---------RSRR-FYSKK-VS--P-KV-
gm004126_Glyma0 ----RSNFLGTKFTVYDAHPPIYGAKVTKS---R------STRL-VSLKQ-VS--P-RV-
Os009471_Os02t0 ----KPNFLGTKFTIFDSQPPCDAVVLP--NN-R------PSKR--HFKQ-VS--P-RL-
pt000712_POPTR_ ----RSNFLGTKFIIYDTQPPYNNAQLAPPG---------RSRR-FYSKK-VS--P-KV-
gm041730_Glyma1 ----RSNFLGTKFTIYDGQPPHAGAKIMKS---R------STRL-VNLKQ-VS--P-KV-
gm045746_Glyma1 ----RSNFLGTKFTIYD----------RKS---C------STELVVNSKQ-VSPRP-RV-
gm036752_Glyma1 ----RSNFLGTKFTIYDSQLPHTGAKIMKS---R------STRL-VNLKQ-VS--P-KV-
gm021741_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGK------TSRR-FYSKK-VS--P-KV-
Os019649_Os04t0 ----RSNFLGTKFIIYDTQPPYNARTLCSQE--R------TSRR-FSSRK-VS--P-KV-
pp022947_Pp1s22 ----RSNFLGTKFTIYDSQPPHSGVVASN----R------GTRR-MGSKQ-LT--S-RV-
pp034735_Pp1s15 ----RSNFLGTKFTIYDSQPSHNGVAASN----R------GAWR-MGTKQ-LS--S-RV-
gm045744_Glyma1 SHFIRSNFLGTKFTIYD----------RKS---C------STELVVNSKQ-VSPRP-RV-
gm001764_Glyma0 ----RSNFLGTKFTIYDSQPPQGAAIQP--DN-R------SSRR-FHSKQ-VS--P-RV-
pt037558_POPTR_ ----RSNFLGTKFTMYDCEPTFEVPTQTQHAN-R------ISRR-FHSRQ-VS--P-RL-
Os022386_Os05t0 ----RSDFLGTKFIIYDSQPPYDGAKPSRS---Q------SSRR-FASKQ-IN--P-NV-
gm045745_Glyma1 ----RSNFLGTKFTIYD----------RKS---C------STELVVNSKQ-VSPRP-RV-
pp022942_Pp1s22 ----RSNFLGTKFTIYDSQPPHSGVVASN----R------GTRR-LGSKQ-LT--S-RV-
Sb028483_Sorbi1 ----RSNFLGTKFVIYDTQPPYNATSPTVAG--K------TNQR-FYSKKGGS--T-KG-
Os009468_Os02t0 ----KPNFLGTKFTIFDSQPPCDAVVLP--NN-R------PSKR--HFKQ-VS--P-RL-
pp034734_Pp1s15 ----RSNFLGTKFTIYDSQPSHNGVAASN----R------GAWR-MGTKQ-LS--S-RV-
gm028526_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAMLSPPG---------RSRR-F-SKK-VS--P-KV-
gm054929_Glyma2 ----RSNFLGTKFIIYDTQPPYHNAMLSPPG---------RSRR-F-SKK-VS--P-KV-
gm034540_Glyma1 ----SSDFLGTNFTIYDSQPPHSGAKPSSG---R------ASRR-FASKQ-IS--P-QV-
Os021774_Os05t0 ----RSNFLGTKFIIYDTQPSYNGAVIPPVG--R------SSRR-FNSKK-VS--P-KM-
Os029803_Os08t0 ----RSNFLGTKFVVYDTQPPYNAGSLMSCQ--H------GSRR-ISSRR-VS--P-KL-
Os022387_Os05t0 ----RSDFLGTKFIIYDSQPPYDGAKPSRS---Q------SSRR-FASKQ-IN--P-NV-
Os022798_Os05t0 ----RSDFWGTNFKIYDNQPPYDDAKTSST---RSSQRFGSTHR-FGSRR-IC--P-QI-
pt039357_POPTR_ ----RSNFLGTKFIIYDTQPPYNNAQLAPPG---------RSRR-FYSKK-VS--P-KV-
gm028527_Glyma1 ----RSNFLGTKFIIYDTQPPYNNAMLSPPG---------RSRR-F-SKK-VS--P-KV-
Os029491_Os07t0 ----RSNFLGTKFTIYDAHPPYAGDVISKG---Q------SARV-IGSNH-LS--P-RI-
Os021773_Os05t0 ----RSNFLGTKFIIYDTQPSYNGAVIPPVG--R------SSRR-FNSKK-VS--P-KM-
gm019438_Glyma0 ----RSNFLGTKFTIYDIPLPHVGAKMTKS---C------FTKL-VNPKQ-VS--P-RV-
Os003209_Os01t0 ----RSDFWGTNFKIYDSKPPYDGAKASSS---R------SSRR-FGSRR-IS--P-QV-
Sb024300_Sorbi1 ----RSNFLGTKFTVYDAHPPCTGAVVSKG---P------SAHM-IGSAQ-VS--P-GV-
gm030080_Glyma1 ----RSNFLGTKFTIYDSQPPHGAAIQP--DS-Q------PSRR-FHSKQ-VS--P-RV-
gm044675_Glyma1 ----RSNFLGTKFTIFDSQAPNDVAIQP--NC-Q------SSRR-FHSKQ-VS--P-RL-
pt001717_POPTR_ ----RSNFLGTKFTIYDSQPPCPGLKS---NC-K------LQQK-VRSIQ-VS--P-GV-
Sm012016_Selmo1 ----RSNFLGTKFTIYDSQPPHVGAMPSNS---R------VGRR-FGSKQ-IS--P-RV-
Os019651_Os04t0 ----RSNFLGTKFIIYDTQPPYNARTLCSQE--R------TSRR-FSSRK-VS--P-KV-
Sb032884_Sorbi1 ----RSDFLGTKFIIYDSQAPYDGAKPSRS---R------STRR-FASKQ-IS--P-QV-
gm003395_Glyma0 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---------RSRR-FYSKK-VS--P-KV-
pt002868_POPTR_ ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---------RSRR-FYSKK-VS--P-KV-
Os040209_Os12t0 ----RSNLLGTKFVIYDTQPPCNTANVSQSG--K------TSRR-FYSRK-VS--P-KN-
pt037730_POPTR_ ----RSNFLGTKFTIYDGQTPCPAMRS---NC-K------PQRK-VRSIQ-VS--P-GV-
gm003396_Glyma0 ----RSNFLGTKFIIYDTQPPYNNAQLSPPG---------RSRR-FYSKK-VS--P-KV-
gm037352_Glyma1 ----SSDFLGTNFTIYDSQPPHSGAKPSSG---R------ASRR-FASKQ-IS--P-QV-
Sb025595_Sorbi1 ----RSDFWGTNFKIYDSKPPYDGAKASSS---R------SSRR-FGSRR-IS--P-QV-
pt037559_POPTR_ ----RSNFLGTKFTMYDCEPTFEVPTQTQHAN-R------ISRR-FHSRQ-VS--P-RL-
pt025486_POPTR_ ----SSDFLGTNFTIFDSQPPHSGAKPSSS---R------ASRR-FASKQ-IS--P-QV-
pt000711_POPTR_ ----RSNFLGTKFIIYDTQPPYNNAQLAPPG---------RSRR-FYSKK-VS--P-KV-
pt034249_POPTR_ ----RSNFLGTKFTVFDGQPPHAGAKMTKS---Y------SSRL-VNLKQ-VS--P-RV-
gm021742_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGK------TSRR-FYSKK-VS--P-KV-
pt000709_POPTR_ ----RSNFLGTKFIIYDTQPPYNNAQLAPPG---------RSRR-FYSKK-VS--P-KV-
Os004869_Os01t0 ----RSNFLGTKFIIYDTQPPYNGAVVPHVG--R------TSKR-FNSTK-VS--P-KV-
gm021740_Glyma0 ----RSNFLGTRFIICDTQPPYSSAHICPPMTGK------TSRR-FYSKK-VS--P-KV-
                     .:: **.* : *                                :          

AT3G06380.1     PQGSYPIAHISYELNVLGSRGP------RRMRCIMDTIPMSIVESRGV-----------V
gm054928_Glyma2 PSGSYNIAHVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGI---VPGQPE-LL
gm003397_Glyma0 PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPE-LL
pt028965_POPTR_ PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLK---------------CPVSQ----
gm048089_Glyma1 AAANYKVATRSKANAVYDALNPHICNPRRRER----------------------PYS--F
gm041219_Glyma1 PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPE-LL
pp034759_Pp1s15 HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACAMESGGS---APTPTE--L
gm021743_Glyma0 PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPE-LL
gm030081_Glyma1 PACNYVVSTIAYELNVLRARGP------RRMHCTMNSIPVSAVQAGGN---APTPT---F
pt001281_POPTR_ PACNYCIATITYELNVLRSRGP------RRMHCIMHSIPMSSIEEGGT---VQTLTS--I
Sm016835_Selmo1 PAGSYNIAHIAYELNVLGTRGP------RRMECTIHSIPASAMEPGGC---APTPLE---
gm039265_Glyma1 SAANYKVATVSYELNVLRTRGP------RRMRCMMHLIPISAIQEGGN---APTPLK--F
Os003208_Os01t0 SAGNYEVGQVSYKYNLLKSRGP------RRMYCALE---------------CPSTQ----
pp005711_Pp1s21 HAGSFNVAHIAYELNVLGTRGP------RRMQCTLHGIPLSTMESVGS---APSPTE--V
Sb019095_Sorbi1 SSGNFDVGQVSYKYNLLKSRGP------RRMLCTME---------------CPSVQ----
gm003133_Glyma0 PACSYLVSTVSYELNVLCTRGP------RRMHCVMNSIPVSAIQEGGN---APTPTS--F
gm039266_Glyma1 SAANYKVATVSYELNVLRTRGP------RRMRCMMHLIPISAIQEGGN---APTPLK--F
gm044960_Glyma1 PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPE-LL
Sb027814_Sorbi1 PLGNYNVATVTYELTVLRNRGP------RRMQCTMHSIPAECIQEGGK---APTPTG--T
gm044959_Glyma1 PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPE-LL
pt000710_POPTR_ PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEPGGS---VPGQPE-LL
gm004126_Glyma0 PAGNYPIAHVSYDLNVLGSRGP------RIMQCVMDAIPASAVEPGGV---APTQTQ--F
Os009471_Os02t0 PLGNYNVATVSYELTVLRNRGP------RRMQCTMHSIPALCIQEGGK---APTPTG--I
pt000712_POPTR_ PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEPGGS---VPGQPE-LL
gm041730_Glyma1 PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPAAAIEPGGV---APVQTE--F
gm045746_Glyma1 PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAVAAPSQTD--F
gm036752_Glyma1 PTGNYPVAHISYELNVLGSRGP------RRMHCVMDSIPATAIEPGGV---APTQTE--F
gm021741_Glyma0 PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPE-LL
Os019649_Os04t0 PTGCYPIVQVNYELNVLGTRGP------RRMQCAMHSIPASAVEPGGI---VPGQPKELL
pp022947_Pp1s22 HCGSYNVAHIAYELNVLGTRGP------RRMQCTMHSIPASAMASGGS---APTPTE--F
pp034735_Pp1s15 HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACAMESGGS---APTPTE--L
gm045744_Glyma1 PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAVAAPSQTD--F
gm001764_Glyma0 PACNYVVSTIAYELNVLRARGP------RRMHCTMNSISVSAVQEGGN---APTPTS--F
pt037558_POPTR_ PACNYSIGTITYELNVLRSRGP------RRMHCMMHSIPMSSIEEGGT---VPTLTS--L
Os022386_Os05t0 SGGNYEVGQVSYKFNFLKSRGP------RRMQCNIQ---------------CPVGQ----
gm045745_Glyma1 PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAVAAPSQTD--F
pp022942_Pp1s22 HCGSHNVAHIAYELNVLGTRGP------RRMQCTMHSIPASAMASGGS---APTPTE--F
Sb028483_Sorbi1 SCSRYSIGQVSYELNVLGTRGP------RRMNCVMHSIPASCLEAGGS---VPCQPDSIV
Os009468_Os02t0 PLGNYNVATVSYELTVLRNRGP------RRMQCTMHSIPALCIQEGGK---APTPTG--I
pp034734_Pp1s15 HSGSYNVAHIAYELNVLGTRGP------RRMQCTLHSIPACAMESGGS---APTPTE--L
gm028526_Glyma1 PSGSYNIAQVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGV---VPGQPE-LL
gm054929_Glyma2 PSGSYNIAHVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGI---VPGQPE-LL
gm034540_Glyma1 PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLK---------------CPVTP---V
Os021774_Os05t0 PSGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASSVEPGGI---VPGQPEQIV
Os029803_Os08t0 PTGSYPIAHVKYELNVLGTRGP------RRMQCTMHSIPASAVDPEGV---VPGQPEQLL
Os022387_Os05t0 SGGNYEVGQVSYKFNFLKSRGP------RRMQCNIQ---------------CPVGQ----
Os022798_Os05t0 SAGNFNVGQISYKYNLLKSRGP------RRMFCTME---------------CPSTQ----
pt039357_POPTR_ PTGSYNIAQVTYELNVLGTRGP------RRMHCTMHSIPALSLEPGGS---VPGQPE-LL
gm028527_Glyma1 PSGSYNIAQVTYELNVLGTRGP------RRMNCTMYSIPASSMEPNGV---VPGQPE-LL
Os029491_Os07t0 PAGNYPVSHISYELNVLGSRGP------RRMHCAMDSIPVSAIEQGGT---APTQTE--F
Os021773_Os05t0 PSGSYNIAQVTYELNVLGTRGP------RRMHCVMHSIPASSVEPGGI---VPGQPEQIV
gm019438_Glyma0 PTGNYPVAHISYELNVLGSRGP------RRMHCVMDTIPASAIEPGGVAV-APSQTD--F
Os003209_Os01t0 SAGNYEVGQVSYKYNLLKSRGP------RRMYCALE---------------CPSTQ----
Sb024300_Sorbi1 PAGNYPISHISYEAT-FGSRYP------RKMNCVMDSIPLSAIKEGGT---APTQTE--F
gm030080_Glyma1 PACNYVVSTIAYELNVLRARGP------RRMHCTMNSIPVSAVQAGGN---APTPT---F
gm044675_Glyma1 PACNYLVSTVSYELNVLCTRGP------RRMYCVMNSIPVSAIQEGGN---APTPAS--Y
pt001717_POPTR_ PARNFNVATVSYELNVLRTRGP------RRMHCIVHSIPISAIQEGGV---APTPLE--F
Sm012016_Selmo1 PSGSYNVAHIAYELNVLGTRGP------RRMQVTIHSIPASAMDPGGV---APTPT---V
Os019651_Os04t0 PTGCYPIVQVNYELNVLGTRGP------RRMQCAMHSIPASAVEPGGI---VPGQPKELL
Sb032884_Sorbi1 SGGNFEVGQVTYKFNFMKSRGP------RRMQCNIQ---------------CPVSQ----
gm003395_Glyma0 PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPE-LL
pt002868_POPTR_ PTGSYNIAQVTYELNVLGTRGP------RRMHCTMHSIPASSLEPGGS---VPGQAE-LL
Os040209_Os12t0 PSSTYSIAQVSYELNVLGTRGP------RRMNCVMHSIPASSLEAGGT---VPCQPDSVL
pt037730_POPTR_ AARNYNVATVSYELNVLRTRGP------RRMHCTIHSIPISAIQEGGI---APTPSE--F
gm003396_Glyma0 PSGSYNIAQITYELNVLGTRGP------RRMNCTMHSIPMSALEPGCT---VPGQPE-LL
gm037352_Glyma1 PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLK---------------CPVTPV--V
Sb025595_Sorbi1 SAGNYEVGQVSYKYNLLKSRGP------RRMYCTLE---------------CPSAQ----
pt037559_POPTR_ PACNYSIGTITYELNVLRSRGP------RRMHCMMHSIPMSSIEEGGT---VPTLTS--L
pt025486_POPTR_ PAGNFEVGQVSYKFNLLKSRGP------RRMVCSLK---------------CPVLQ----
pt000711_POPTR_ PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEPGGS---VPGQPE-LL
pt034249_POPTR_ PTGNYPVANISYELNVLGSRGP------RRMHCIMDAIPAAAIEPGGV---APTQTE--F
gm021742_Glyma0 PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPE-LL
pt000709_POPTR_ PTGSYNIAHVTYELNVLGTRGP------RRMHCTMHSIPVSSLEPGGS---VPGQPE-LL
Os004869_Os01t0 PSVTYNIAQVSYELNVLGTRGP------RRMRCMMHSIPASSVEPGGI---VPGQPEQIV
gm021740_Glyma0 PSGSYNIAQVTYELNVLGTRGP------RKMHCVMHSIPASALDAGGT---VPGQPE-LL
                    . :              *      *                               

AT3G06380.1     ASTS-ISSFSSRSSPV--------------FRSHSKPL----RSNSASCSDSGNN-----
gm054928_Glyma2 PRAL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSD-------IM
gm003397_Glyma0 PRSL-EDSFRS--ISFARS------------IDNST------EFSSSRFSD-------IF
pt028965_POPTR_ ------ETTNV------------------------------KNVDNSKMTQLES------
gm048089_Glyma1 -----EHASTT--TPDSKGKKPEVV-----------------EFDSTGTAN-------TP
gm041219_Glyma1 PRSL-EDSFRS--ISFSKS------------LDHSI------EFSSSRFSE-------IG
pp034759_Pp1s15 AAGS-LEE-VH--VPYSSIMS--------SPRSKAA------VVDSSALESS------EF
gm021743_Glyma0 PRPL-EDSFRS--ISFSKS------------LDRSI------EFSSSRFSE-------IG
gm030081_Glyma1 PEII-DEPFSP--SPALKGKGP-IR-----------------DLDNASLPEL------LP
pt001281_POPTR_ PEAF-NGQFPH--LSSSIGKEL-VS-----------------DNSSASPSR-------SP
Sm016835_Selmo1 SATS-MDEASM--LPP--LLL--------PVGAKSS------KV---AALDG------LE
gm039265_Glyma1 TNYLNDYASTT--IPDTKGKKPEVV-----------------EFDSTGTDN-------TP
Os003208_Os01t0 ------ETWEN------------------------------C------LKTKFR------
pp005711_Pp1s21 TADS-LER-AH--VPHSGVMS--------SSRSKAA------VVDISTLD-Y------DF
Sb019095_Sorbi1 ------ETWEN------------------------------S------LKVMSF------
gm003133_Glyma0 PQIF-DEPFSP--SPALKEKAQ-VT-----------------DLNSASLSE-------PP
gm039266_Glyma1 TNYLNDYASTT--IPDTKGKKPEVV-----------------EFDSTGTDN-------TP
gm044960_Glyma1 PRSL-EDSFRS--ISFARS------------IDNST------EFSSSRFSD-------IF
Sb027814_Sorbi1 IQSL-DEPVST--SPSTKGKEV-AL-----------------EFSSTSLSAD------LS
gm044959_Glyma1 PRSL-EDSFRS--ISFARS------------IDNST------EFSSSRFSD-------IF
pt000710_POPTR_ PCSL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSN-------IV
gm004126_Glyma0 LHSR-IDTSPS--IPF--------------FRSKST-----------RMDNL------PT
Os009471_Os02t0 IHSL-DEQVPA--LSTSKGKEP-AI-----------------EFSSTSLSAD------LS
pt000712_POPTR_ PCSL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSN-------IV
gm041730_Glyma1 SLNN-IDMFPS--FPF--------------FRSKSN-----------RVENS------VS
gm045746_Glyma1 SVSN-RD--TS--FPF--------------FQTNST-----------SLENS------IS
gm036752_Glyma1 SLNN-IDMFPS--FPF--------------FRSKSN-----------RAENS------MS
gm021741_Glyma0 PRPL-EDSFRS--ISFSKS------------LDRSI------EFSSSRFSE-------IG
Os019649_Os04t0 PRLF-EESFRSMATSFSKY----------SITDHST------DFSSSRFSE-------FG
pp022947_Pp1s22 TSCG-LEE-AH--VPYSSILL--------SPRSKAA------VVDSSALESS------EL
pp034735_Pp1s15 AAGS-LEE-VH--VPYSSIMS--------SPRSKAA------VVDSSALESS------EF
gm045744_Glyma1 SVSN-RD--TS--FPF--------------FQTNST-----------SLENS------IS
gm001764_Glyma0 PQII-DEPFSP--SPALKGKGP-IR-----------------DLDNASLPEL------LP
pt037558_POPTR_ TETF-GGQFPH--LSTSKGKES-VS-----------------DISSPSPSQ-------SP
Os022386_Os05t0 ------STASD------------------------------P------LK-KLI------
gm045745_Glyma1 SVSN-RD--TS--FPF--------------FQTNST-----------SLENS------IS
pp022942_Pp1s22 TSCG-LEE-AH--VPYSSILL--------SPRSKAA------VVDSSALESS------EL
Sb028483_Sorbi1 AHSV-GEMFSS--IPLSKS----------STMDHSM------HFSSSRFSDAITADAIVS
Os009468_Os02t0 IHSL-DEQVPA--LSTSKGKEP-AI-----------------EFSSTSLSAD------LS
pp034734_Pp1s15 AAGS-LEE-VH--VPYSSIMS--------SPRSKAA------VVDSSALESS------EF
gm028526_Glyma1 PRAL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSD-------IM
gm054929_Glyma2 PRAL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSD-------IM
gm034540_Glyma1 SPT--SGSSDS------------------------------TPVNGHKMHDKEQ------
Os021774_Os05t0 PRAF-EESFRST-TSFSKS----------SIMDRSMDFSSSRDFSSARFSD-------IA
Os029803_Os08t0 PGPF-EESFRSTNTS-SRF----------SFMDRSL------DFSSSRFSE-------IS
Os022387_Os05t0 ------STASD------------------------------P------LK-KLI------
Os022798_Os05t0 ------ETWEN------------------------------S------LKTKSL------
pt039357_POPTR_ PRCL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSD-------IV
gm028527_Glyma1 PRAL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSD-------IM
Os029491_Os07t0 PLSY-HESFTS--IPF--------------FKSKSV-----------RANNS-------T
Os021773_Os05t0 PRAF-EESFRST-TSFSKS----------SIMDRSMDFSSSRDFSSARFSD-------IA
gm019438_Glyma0 SVSN-ID--TS--FPF--------------FQTNST-----------SLENS------IS
Os003209_Os01t0 ------ETWEN------------------------------C------LKTKFR------
Sb024300_Sorbi1 PSIN-SNSFAS--VPF--------------FR-KSG-----------RLDSS-------G
gm030080_Glyma1 PEII-DEPFSP--SPALKGKGP-IR-----------------DLDNASLPEL------LP
gm044675_Glyma1 PQIF-DEHFSP--SPALKEKVP-VT-----------------DLNSASLSE-------PP
pt001717_POPTR_ NNPG-DEQSPS--LSASKVKQP-LI-----------------DFISTSRAE-------SS
Sm012016_Selmo1 FANP-LED-AQ--LPF--------------PVSKSK------VSDCSTAPVV------VP
Os019651_Os04t0 PRLF-EESFRSMATSFSKY----------SITDHST------DFSSSRFSE-------FG
Sb032884_Sorbi1 ------GTMSD------------------------------P------SK-EKT------
gm003395_Glyma0 PRSL-EDSFRS--ISFARS------------IDNST------EFSSSRFSD-------IF
pt002868_POPTR_ PRSL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSD-------IV
Os040209_Os12t0 ARSL-DESFGS--ISFSKS----------SIMDRSI------RFSSSRYSD-------IS
pt037730_POPTR_ NNPS-NEQSSP--LSASKLKQP-PI-----------------DFSSNSLAE-------SS
gm003396_Glyma0 PRSL-EDSFRS--ISFARS------------IDNST------EFSSSRFSD-------IF
gm037352_Glyma1 SPS--VESSDS------------------------------TPVNGHKIPDKEQ------
Sb025595_Sorbi1 ------ETWEN------------------------------S------LKTKFR------
pt037559_POPTR_ TETF-GGQFPH--LSTSKGKES-VS-----------------DISSPSPSQ-------SP
pt025486_POPTR_ ------ETIND------------------------------KILDNSKMNGLES------
pt000711_POPTR_ PCSL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSN-------IV
pt034249_POPTR_ YHHS-ADFFPS--LLF--------------FRSKSN------RV--ERVESF------QS
gm021742_Glyma0 PRPL-EDSFRS--ISFSKS------------LDRSI------EFSSSRFSE-------IG
pt000709_POPTR_ PCSL-EDSFRS--ISFSKS------------IDNST------EFSSSRFSN-------IV
Os004869_Os01t0 PRAL-EDSFRST-TSFSQSFRS-TTSFSKSIMDPSM------DFSSARFSD-------IS
gm021740_Glyma0 PRPL-EDSFRS--ISFSKS------------LDRSI------EFSSSRFSE-------IG
                                                                            

AT3G06380.1     -------------------LGDPPLVLSNKAPRWHEQLRCWCLNFHGRVTVASVKNFQLV
gm054928_Glyma2 G-I----------GNEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
gm003397_Glyma0 V-A----------GNEEEQGKGRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
pt028965_POPTR_ -------------------ASSGFTVLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
gm048089_Glyma1 E--SIQ-------------RAREPLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
gm041219_Glyma1 E-S----------CIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLI
pp034759_Pp1s15 V-SGLL-------------NKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
gm021743_Glyma0 E-S----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLI
gm030081_Glyma1 V--ESQ-------------GSAEPLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
pt001281_POPTR_ V--LAQ-------------GSEELLVLKNKAPRWHEQLQCSCLNFRGRVTVASVKNFQLV
Sm016835_Selmo1 G-LEVA-------------SKGKPLVLKNKPPRWHDQLQCWCLNFRGRVTVASVKNFQLV
gm039265_Glyma1 E--SIQ-------------RAREPLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
Os003208_Os01t0 -------------------KPTGNTVLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
pp005711_Pp1s21 A-SGLL-------------AKDEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
Sb019095_Sorbi1 -------------------RQTGSTILRNNAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
gm003133_Glyma0 V--LSQ-------------GSTEQLALKNKAPRWHEQLQCWCLNFKGRVSVASVKNFQLV
gm039266_Glyma1 E--SIQ-------------RAREPLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
gm044960_Glyma1 L-A----------GKEEEQGKDRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
Sb027814_Sorbi1 GLALAC-------------ANETPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
gm044959_Glyma1 L-A----------GKEEEQGKDRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
pt000710_POPTR_ G-P----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLV
gm004126_Glyma0 V-PLTC-------------QNEGTLVLRNKSPRWHEHLQCWCLNFNGRVTVASVKNFQLV
Os009471_Os02t0 G--PVC-------------TNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
pt000712_POPTR_ G-P----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLV
gm041730_Glyma1 G-PLVD-------------QKDGMLVLKNKAPRWHEQLQCWCLNFHGRVTIASVKNFQLV
gm045746_Glyma1 G-DQSN-------------KKDDVLVLRNKAARWHEQLQCWCLNFHGRVTIASVKNFQLA
gm036752_Glyma1 G-PLVD-------------QKDGMLVLKNKAPRWHEQLQCWCLNFHGRVTIASVKNFQLV
gm021741_Glyma0 E-S----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLI
Os019649_Os04t0 G-GALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLI
pp022947_Pp1s22 V-SGVL-------------CKEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
pp034735_Pp1s15 V-SGLL-------------NKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
gm045744_Glyma1 G-DQSN-------------KKDDVLVLRNKAARWHEQLQCWCLNFHGRVTIASVKNFQLA
gm001764_Glyma0 V--QSQ-------------DSAEPLVLKNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLV
pt037558_POPTR_ V--LTQ-------------GSEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
Os022386_Os05t0 -------------------STSSPLALRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
gm045745_Glyma1 G-DQSN-------------KKDDVLVLRNKAARWHEQLQCWCLNFHGRVTIASVKNFQLA
pp022942_Pp1s22 V-SGVL-------------CKEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
Sb028483_Sorbi1 G-G------QALSNADDEESTDTPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
Os009468_Os02t0 G--PVC-------------TNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
pp034734_Pp1s15 V-SGLL-------------NKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
gm028526_Glyma1 G-T----------GIEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
gm054929_Glyma2 G-I----------GNEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
gm034540_Glyma1 -------------------AASGYTILKNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
Os021774_Os05t0 G-GT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLI
Os029803_Os08t0 G-SANQ-----QGEDDIPEAKERPLVLRNKVPRWHEQLQCWCLNFRGRVTVASVKNFQLI
Os022387_Os05t0 -------------------STSSPLALRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
Os022798_Os05t0 -------------------RCTGTTVLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
pt039357_POPTR_ G-P----------REEDEEGKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLI
gm028527_Glyma1 G-T----------GIEDEEGKVRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
Os029491_Os07t0 A-SLLT-------------QNGSKLVLKNKSPRWHEHLQCWCLNFHGRVTVASVKNFQLV
Os021773_Os05t0 G-GT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASVKNFQLI
gm019438_Glyma0 G-DQRN-------------KKDDVLVLRNKAARWHEQLECWCLNFHGRVTIASVKNFQLA
Os003209_Os01t0 -------------------KPTGNTVLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
Sb024300_Sorbi1 V-QLAT-------------QNEAKMVLKNKSPNWHEPLQCWCLNFHGRVTVASVKNFQLV
gm030080_Glyma1 V--ESQ-------------GSAEPLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
gm044675_Glyma1 V--SSQ-------------CSAEQLALKNRAPRWHEQLQCWCLNFKGRVSVASVKNFQLV
pt001717_POPTR_ D--SIC-------------SKMDPLVLKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
Sm012016_Selmo1 Y-SGVM-------------SKDGPLVLKNKAPRWHDQLQCWCLNFRGRVTVASVKNFQLV
Os019651_Os04t0 G-GALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLI
Sb032884_Sorbi1 -------------------PSSSSLDLKNKAPRWHDHLQCWCLNFHGRVTVASVKNFQLV
gm003395_Glyma0 V-A----------GNEEEQGKGRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
pt002868_POPTR_ G-P----------R-EDEEGKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLI
Os040209_Os12t0 V-GGPM--VGGQALGDSDESKERPLILRNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
pt037730_POPTR_ D--SLC-------------SKNDPLILKNKAPRWHEQLQCWCLNFKGRVTVASVKNFQLV
gm003396_Glyma0 V-A----------GNEEEQGKGRPLVLKNKSPRWHEQLQCWCLNFRGRVTVASVKNFQLI
gm037352_Glyma1 -------------------VASGYTILKNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
Sb025595_Sorbi1 -------------------RPLGPTTLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
pt037559_POPTR_ V--LTQ-------------GSEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLV
pt025486_POPTR_ -------------------ASSGCTVLRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLV
pt000711_POPTR_ G-P----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLV
pt034249_POPTR_ G-PLSS-------------QREGALVLRNKAPRWHEQLQCWCLNFHGRVTVASVKNFQLV
gm021742_Glyma0 E-S----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLI
pt000709_POPTR_ G-P----------REEDEEGKERPLVLRNKSPRWHEQLQCWCLNFRGRVSVASVKNFQLV
Os004869_Os01t0 G-SI-------MGGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIASVKNFQLV
gm021740_Glyma0 E-S----------IIEDDDGKMRPLVLKNKPPRWHEQLQCWCLNFRGRVTVASVKNFQLI
                                          * *. ..**: *.* ****.***::******** 

AT3G06380.1     AV--SDCEA-----------------G----------------------------QTSER
gm054928_Glyma2 AA--TPPPAI----VTTGTG----------PTP-SQPTQS--------------SSDPDK
gm003397_Glyma0 AA--TQPPA--------AGA----------PTPSSQPAQ----------------SDHDK
pt028965_POPTR_ AI--MDQSQ---------------------PGG---------------------KGDEET
gm048089_Glyma1 AA--AEPCQ-------NVSA-----------------------------------AEQEK
gm041219_Glyma1 AA--TQPAA---------GA----------PTP-SQPAP----------------PEHDK
pp034759_Pp1s15 AA--------TSVKAVSAAATT-------------SSSS----------------ADHDK
gm021743_Glyma0 AA--TQPPA---------GA----------PTP-SQPAP----------------PEHDK
gm030081_Glyma1 SA--VDPSH-------NVSA-----------------------------------AEQEK
pt001281_POPTR_ AS--AEPSH-------NVPA-----------------------------------ADQER
Sm016835_Selmo1 AA--TEIGQ--------------------------PPQP----------------SDPDN
gm039265_Glyma1 AA--AEPCQ-------NVSA-----------------------------------AEQEK
Os003208_Os01t0 AA--ADPND---------------------PAS---------------------SKDEET
pp005711_Pp1s21 AS--MES--------------------------LPTSSQ----------------SDRDK
Sb019095_Sorbi1 AT--TDTSH---------------------PDS---------------------VDDAE-
gm003133_Glyma0 AA--VDPSH-------NISA-----------------------------------EEQEK
gm039266_Glyma1 AA--AEPCQ-------NVSA-----------------------------------AEQEK
gm044960_Glyma1 AA--TQPPA--------TGA----------PTPSSQPAQ----------------SDHDK
Sb027814_Sorbi1 AS--VDPSL-------NIPA-----------------------------------AEQEK
gm044959_Glyma1 AA--TQPPA--------TGA----------PTPSSQPAQ----------------SDHDK
pt000710_POPTR_ AA--TQPAA---------GA----------PTP-SQPAQ----------------SDHDK
gm004126_Glyma0 AS--PKN----------------------------GVSE----------------QAQEN
Os009471_Os02t0 AS--VDPSL-------GIPA-----------------------------------AEQEK
pt000712_POPTR_ AA--TQPAA---------GA----------PTP-SQPAQ----------------SDHDK
gm041730_Glyma1 AS--AEN----------------------------RPAG----------------PEHDK
gm045746_Glyma1 VS--PEN----------------------------GHAG----------------LQEDE
gm036752_Glyma1 AS--AEN----------------------------GPAG----------------PEHDK
gm021741_Glyma0 AA--TQPPA---------GA----------PTP-SQPAP----------------PEHDK
Os019649_Os04t0 AAA-PQPSS---------GAAS-------EPSQAGQAAQQQTQPSQPSSSSSSSSSNHDT
pp022947_Pp1s22 AA--TTSSTTTSTTAGEAAAATGGGGGAGAATPAPTSSG----------------SDHDK
pp034735_Pp1s15 AA--------TSVKAVSAAATT-------------SSSS----------------ADHDK
gm045744_Glyma1 VS--PEN----------------------------GHAG----------------LQEDE
gm001764_Glyma0 AA--VDPSH-------NVSA-----------------------------------AEQEK
pt037558_POPTR_ AA--VESFH-------NVSS-----------------------------------ADQER
Os022386_Os05t0 AP--AGTSD---------------------PWG---------------------IADEET
gm045745_Glyma1 VS--PEN----------------------------GHAG----------------LQEDE
pp022942_Pp1s22 AA--TTSSTTTSTTAGEAAAATGGGGGAGAATPAPTSSG----------------SDHDK
Sb028483_Sorbi1 AAVMTQPAV---------GA----------PTP-SQAAP----LPLPAPAPGPPLPDQEK
Os009468_Os02t0 AS--VDPSL-------GIPA-----------------------------------AEQEK
pp034734_Pp1s15 AA--------TSVKAVSAAATT-------------SSSS----------------ADHDK
gm028526_Glyma1 AS--TPPAAV----APTGTG----------PTP-SQPTQS--------------SSDPDK
gm054929_Glyma2 AA--TPPPAI----VTTGTG----------PTP-SQPTQS--------------SSDPDK
gm034540_Glyma1 AT--VDQSQ---------------------PGG---------------------KGDEET
Os021774_Os05t0 AAP-AQPPA---------GA----------PTP-SQPAP----------------PEQDK
Os029803_Os08t0 AAA---------------------------SSESSQLEQQQQQQQQNHASSSSSASDHGK
Os022387_Os05t0 AP--AGTSD---------------------PWG---------------------IADEET
Os022798_Os05t0 AT--ADPSH---------------------PDS---------------------VGDEET
pt039357_POPTR_ AA--TQPAA---------GA----------PTP-SQPAQ----------------SDHDK
gm028527_Glyma1 AS--TPPAAV----APTGTG----------PTP-SQPTQS--------------SSDPDK
Os029491_Os07t0 AS--DES----------------------------NPTN----------------QEHDD
Os021773_Os05t0 AAP-AQPPA---------GA----------PTP-SQPAP----------------PEQDK
gm019438_Glyma0 VS--PEN----------------------------GHAG----------------PQEDE
Os003209_Os01t0 AA--ADPND---------------------PAS---------------------SKDEET
Sb024300_Sorbi1 AS--GES----------------------------DLNN----------------QGDDD
gm030080_Glyma1 SA--VDPSH-------NVSA-----------------------------------AEQEK
gm044675_Glyma1 AA--VDPSH-------NISA-----------------------------------EEQEK
pt001717_POPTR_ AA--VEPCQ-------NVPV-----------------------------------EEQEK
Sm012016_Selmo1 AA--LEPG---------------------------QQAH----------------ADHDK
Os019651_Os04t0 AAA-PQPSS---------GAAS-------EPSQAGQAAQQQTQPSQPSSSSSSSSSNHDT
Sb032884_Sorbi1 AT--AGSGG---------------------PWG---------------------VGDEET
gm003395_Glyma0 AA--TQPPA--------AGA----------PTPSSQPAQ----------------SDHDK
pt002868_POPTR_ AA--TQPAA---------GA----------PTP-SQPVQ----------------SDHDK
Os040209_Os12t0 AA--TQPAA---------GA----------PTP-SQPAPP-------------PPPDHDK
pt037730_POPTR_ AA--VEPCQ-------NVPV-----------------------------------EEQEK
gm003396_Glyma0 AA--TQPPA--------AGA----------PTPSSQPAQ----------------SDHDK
gm037352_Glyma1 AT--VDQSQ---------------------PGG---------------------KGDEET
Sb025595_Sorbi1 AA--ADPSD---------------------PTS---------------------SVDDET
pt037559_POPTR_ AA--VESFH-------NVSS-----------------------------------ADQER
pt025486_POPTR_ AT--MDQSQ---------------------PGG---------------------RGDEDT
pt000711_POPTR_ AA--TQPAA---------GA----------PTP-SQPAQ----------------SDHDK
pt034249_POPTR_ AS--QEN----------------------------GPAG----------------PEHEN
gm021742_Glyma0 AA--TQPPA---------GA----------PTP-SQPAP----------------PEHDK
pt000709_POPTR_ AA--TQPAA---------GA----------PTP-SQPAQ----------------SDHDK
Os004869_Os01t0 AAP-SPPPA---------GA----------PTP-SQPGP----------------ADPEK
gm021740_Glyma0 AA--TQPPA---------GA----------PTP-SQPAP----------------PEHDK
                                                                            

AT3G06380.1     IILQFGKVGKDMFTMDYGYPISAFQAFAICLSSFETR--IACE-----
gm054928_Glyma2 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
gm003397_Glyma0 IILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
pt028965_POPTR_ VLLQFGKVGDDTFTMDYRQPLSAFQAFALCLTSFGTK--LACE-----
gm048089_Glyma1 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
gm041219_Glyma1 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
pp034759_Pp1s15 VLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm021743_Glyma0 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm030081_Glyma1 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
pt001281_POPTR_ VILQFGKIGKDIFTMDYFYPLSAFQAFAICLSSFDTK--PACE-----
Sm016835_Selmo1 VILQFGKIGKDTFTMDYRYPLSAFQAFAISLSSFDTKDSLHCTYALMF
gm039265_Glyma1 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
Os003208_Os01t0 VLLQFGKVDDNIFTMDYRQPLSAFQAFAISLSSFGTK--LACE-----
pp005711_Pp1s21 VLLQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
Sb019095_Sorbi1 IVLQFGKVGDDIFTMDYRQPLSAFQAFAICLSSFGTK--LACE-----
gm003133_Glyma0 VILQFGKIGKDIFTMDYCYPLSTFQAFAICLSSFDTK--PACE-----
gm039266_Glyma1 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
gm044960_Glyma1 IILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
Sb027814_Sorbi1 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTK--PACE-----
gm044959_Glyma1 IILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
pt000710_POPTR_ VILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm004126_Glyma0 VILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTK--IACE-----
Os009471_Os02t0 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTK--PACE-----
pt000712_POPTR_ VILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm041730_Glyma1 IILQFGKVGKDLFTMDYRFPISAFQAFAICLSSFDTK--IACE-----
gm045746_Glyma1 VILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE-----
gm036752_Glyma1 IILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTK--IACE-----
gm021741_Glyma0 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
Os019649_Os04t0 VILQFGKVAKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
pp022947_Pp1s22 VLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
pp034735_Pp1s15 VLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm045744_Glyma1 VILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE-----
gm001764_Glyma0 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
pt037558_POPTR_ VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
Os022386_Os05t0 VILQFGKIEDDAFTMDYRQPLSAFQAFAICLTSFGTK--LACE-----
gm045745_Glyma1 VILQFGKIGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE-----
pp022942_Pp1s22 VLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
Sb028483_Sorbi1 VLLQFGKVGKDIFTMDYCYPLSAFQAFAICLSSFDTK--LACE-----
Os009468_Os02t0 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLTSFDTK--PACE-----
pp034734_Pp1s15 VLLQFGKIGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm028526_Glyma1 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
gm054929_Glyma2 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
gm034540_Glyma1 VLLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTK--LACE-----
Os021774_Os05t0 IILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
Os029803_Os08t0 VILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
Os022387_Os05t0 VILQFGKIEDDAFTMDYRQPLSAFQAFAICLTSFGTK--LACE-----
Os022798_Os05t0 VILQFGKVDSNIFTMDYRQPLSAFQAFAICLSSFGTK--LACE-----
pt039357_POPTR_ IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm028527_Glyma1 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
Os029491_Os07t0 VILQFGKVGKDMFTMDYRYPISAFQAFAICLSSFDTK--IACE-----
Os021773_Os05t0 IILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm019438_Glyma0 VILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFATT--VACE-----
Os003209_Os01t0 VLLQFGKVDDNIFTMDYRQPLSAFQAFAISLSSFGTK--LACE-----
Sb024300_Sorbi1 VILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTK--ITRE-----
gm030080_Glyma1 VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
gm044675_Glyma1 VILQFGKIGKDIFTMDYCYPLSTFQAFAICLSSFDTK--PACE-----
pt001717_POPTR_ VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
Sm012016_Selmo1 VLLQFGKIGKDMFTMDYRYPLSAFQAFGICLSSFDTK--LACE-----
Os019651_Os04t0 VILQFGKVAKDMFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
Sb032884_Sorbi1 VILQFGKIEDDAFTMDYRQPLSAFQAFAICLTSFGTK--LACE-----
gm003395_Glyma0 IILQFGKVGKDIFTMDYRYPLSAFQAFAICLTSFDTK--LACE-----
pt002868_POPTR_ IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
Os040209_Os12t0 VILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
pt037730_POPTR_ VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
gm003396_Glyma0 IILQFGK--QTIYVL---LPCSVMGFFLW-------------------
gm037352_Glyma1 VLLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTK--LACE-----
Sb025595_Sorbi1 VLLQFGKVDEDMFTMDYRQPLSAFQAFAISLSSFGTK--LACE-----
pt037559_POPTR_ VILQFGKIGKDIFTMDYRYPLSAFQAFAICLSSFDTK--PACE-----
pt025486_POPTR_ VLLQFGKVGEDTFTMDYRLPLSAFQAFAICLTSFGTK--LACE-----
pt000711_POPTR_ VILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
pt034249_POPTR_ IILQFGKVGKDLFTMDYRYPISAFQAFAICLSSFDTK--IACE-----
gm021742_Glyma0 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
pt000709_POPTR_ VILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
Os004869_Os01t0 VILQFGKVARDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
gm021740_Glyma0 IILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTK--LACE-----
                ::*****     :.:    * *.:  *                     


BoxShade v3.31 C (beta, 970507) Output
AT3G06380.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054928_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt028965_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm048089_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041219_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034759_Pp1s15    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021743_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030081_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001281_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm016835_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K - - - - - - - - S S
gm039265_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os003208_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb019095_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003133_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039266_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044960_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb027814_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044959_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000710_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm004126_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os009471_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000712_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019649_Os04t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034735_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R - - - - - - - S G S
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037558_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022386_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022942_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb028483_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os009468_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034734_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R - - - - - - - S G S
gm028526_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054929_Glyma2    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm034540_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os021774_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029803_Os08t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022387_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022798_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt039357_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028527_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029491_Os07t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os021773_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os003209_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb024300_Sorbi1    - - A E E C - - - - - - - - - - - - - - - - - - - - - - - - S C G - G G G G F - - - - W R V G G R E - - - - - - R Q A S
gm030080_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044675_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001717_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm012016_Selmo1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M S G K K S - - - - - S S S S
Os019651_Os04t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb032884_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - I F G A V S S P F F F P L S F
gm003395_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt002868_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os040209_Os12t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037730_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm037352_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb025595_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037559_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt025486_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000711_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt034249_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021742_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000709_POPTR_    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os004869_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021740_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
 
AT3G06380.1     - - M T F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S L L Q E - - - - - - - - - - - - - - -
gm054928_Glyma2    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
gm003397_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
pt028965_POPTR_    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R R S F L S - R R F S R S F N N Q N R N E
gm048089_Glyma1    - - M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E L K E I G E G I S N M Y R R -
gm041219_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
pp034759_Pp1s15    - - M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S L I R E F Q E M K G G R G G I S R R -
gm021743_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
gm030081_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L K E M R D G I G S M S R R -
pt001281_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I M R E F K E I K E G I G S I S R R -
Sm016835_Selmo1    T L T P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - W S V I Q D - - - I K - G I G S I S R R -
gm039265_Glyma1    - - M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E L K E I G E G I S N M Y R R -
Os003208_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P R E T P P -
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M K S G V G R I S R R -
Sb019095_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M A A P L V P -
gm003133_Glyma0    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E L K E M R D G I G S T S K R -
gm039266_Glyma1    - - M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E L K E I G E G I S N M Y R R -
gm044960_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
Sb027814_Sorbi1    A A M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L K E M R D G I G S M S R R G
gm044959_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
pt000710_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - M R D G F G S L S R R -
gm004126_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I I L E - - - - - - - - - - - - R K -
Os009471_Os02t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M R D G I G S M S R R -
pt000712_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - M R D G F G S L S R R -
gm041730_Glyma1    - M C L I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S M - - - - - - - - - - - - - - - - - -
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
Os019649_Os04t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - F R D S F G T L S K R -
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M K G G I G N I S R R -
pp034735_Pp1s15    S M M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S L I R E F Q E M K G G R G G I S R R -
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm001764_Glyma0    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L K E M R D G I G S M S R R -
pt037558_POPTR_    - - M S I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L K E M K D G I G N I S R R -
Os022386_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M A L W - R C S S S W L S S V S R S S
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022942_Pp1s22    - - M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S L I R E F Q E M K G G I G N I S R R -
Sb028483_Sorbi1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
Os009468_Os02t0    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L R E M R D G I G S M S R R -
pp034734_Pp1s15    S M M P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S L I R E F Q E M K G G R G G I S R R -
gm028526_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E - - - V R D G F G S L S R R -
gm054929_Glyma2    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
gm034540_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R K V F R S - R K F S K S F K E V L P A E
Os021774_Os05t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
Os029803_Os08t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
Os022387_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M A L W - R C S S S W L S S V S R S S
Os022798_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M A A V R E P -
pt039357_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - M R D G F G S L S R R -
gm028527_Glyma1    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E - - - V R D G F G S L S R R -
Os029491_Os07t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S V I Q E - - - V K G E I G A I S R R -
Os021773_Os05t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Os003209_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P R E T P P -
Sb024300_Sorbi1    G D M P F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - S S M I H E - - - M K G E I G A I S S R -
gm030080_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L K E M R D G I G S M S R R -
gm044675_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R E L K E M R D G I G S T S K R -
pt001717_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S - - - K L K E I R D D I T T T F S M G
Sm012016_Selmo1    S L L P L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I L R E F Q D I R D G I G S L S R R -
Os019651_Os04t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - F R D S F G T L S K R -
Sb032884_Sorbi1    S F L S L A S L P C S L P P P A P F I P P S A R A N L F R G R A G I G A R R P P V M I S W - R R S A S W L S S A S R S S
gm003395_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
pt002868_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - M R D G F G S L S R R -
Os040209_Os12t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
pt037730_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K G - - - K L K E I R D D I S T T F S M G
gm003396_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
gm037352_Glyma1    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R K V F R S - R K F S R S F K E V L P A E
Sb025595_Sorbi1    - - - - - - - - - - - - - - - - - - - - - - - - - - - V H K R A K K E E E R E K R K G E A - R D C S G E M S R H A A P A
pt037559_POPTR_    - - M S I - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I V R E L K E M K D G I G N I S R R -
pt025486_POPTR_    - - M S L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R R S I L S - R R F S R S F N N Q N R N E
pt000711_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - M R D G F G S L S R R -
pt034249_POPTR_    - M P A L - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - K S I I - - - - - - - - - - - - - - - - -
gm021742_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
pt000709_POPTR_    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - M R D G F G S L S R R -
Os004869_Os01t0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D G F G S L S R R -
gm021740_Glyma0    - - M S F - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - R S I V R D - - - V R D S F G S L S R R -
 
AT3G06380.1     - - - - - - - - - - - - - - - - - - - - M R S R P H R V V H A A A S T A N - - - - - - - - - - - - - S S D P F S W S E L
gm054928_Glyma2    - - - - - S F E V R - - - - - - L P G H N R G K S R S S V H E L Q D Q P P - - - - - - - - - - - - - V I Q N S R W A S L
gm003397_Glyma0    - - - - - S F D V R - - - - - - I S G G - - G K L N S L V H E A H E R Q L - - - - - - - - - - - - - V I Q N S R W A S L
pt028965_POPTR_    R N G V - - - - - - - - - - - - - - - - E S G R L V G - - - - - E - - - - - - - - - - - - - - - - S G G E S D G W G S M
gm048089_Glyma1    - - - - - G G E A K - - - - - - - H V H R H G K S - H I A P E C S L P P P P S S S S S S S S S S - - - S W Q S R W A N L
gm041219_Glyma1    - - - - - S F D V R - - - - - - L T G H H R G K S Q G S V Q D L H D Q P L - - - - - - - - - - - - - V I Q N S R W A S L
pp034759_Pp1s15    - - - - - S F E L K - - - - - - F P H H H K G R S S G M V L D E S Q L R V E A V - - - - - - - - - - - V K Q S C W A N M
gm021743_Glyma0    - - - - - S F D V R - - - - - - L T G H H R G K S Q G S V Q D L H D Q P L - - - - - - - - - - - - - V I Q N S R W A S L
gm030081_Glyma1    - - - - - G V E S R - - - - - - - R W N G R T K S - H V A P D V T L T S L E P I Q Q G H - - - - - - - - - - - - W A N L
pt001281_POPTR_    - - - - - G V E G K - - - - - - - H W C G R V R S - H I A P D E T R E E T D Q I D Q G Q - - - - - - - - - - - - W A N L
Sm016835_Selmo1    - - - - - S F E V K - - - - - - L P T Y S R S R S H S A A Q D A A G R H Q F G E - - - - - - - - - - S G Q Q S R W A N M
gm039265_Glyma1    - - - - - G G E A K - - - - - - - H V H R H G K S - H I A P E C S L P P P P P P P P S S S S - - - - - - - Q S R W A N L
Os003208_Os01t0    - - - - - - - - - - - - - - - P P P - P E G G E V H E V - V E G E - - - - - - - - - - - - - D G Q A E D Q E E R W A R L
pp005711_Pp1s21    - - - - - S F E L K - - - - - - F P H H H R G R S S G M V L D E S Q L N S E P V - - - - - - - - - - - V E Q S C W A N M
Sb019095_Sorbi1    - - - - - - - - - - - - - - - - - - - R E E G L R Q E G A V E Q E - - - - - - - - - - - - - - - - - - - E E D R W A C L
gm003133_Glyma0    - - - - - G A E S K - - - - - - - H R L S R T K S - H V A P D V L A T P F E P I Q Q G Q - - - - - - - - - - - - W A N L
gm039266_Glyma1    - - - - - G G E A K - - - - - - - H V H R H G K S - H I A P E C S L P P P P P P P P S S S S - - - - - - - Q S R W A N L
gm044960_Glyma1    - - - - - S F D V R - - - - - - L S G G - - G K S N S L V H E E H E C L P - - - - - - - - - - - - - V V Q N S R W A S L
Sb027814_Sorbi1    G - - - S G S D G R - - - - - - - A G H G R S G S R H S W P S L W A E Q Q Q P Q R Q G Q E G P Q H Q H Q H Q G R W A N L
gm044959_Glyma1    - - - - - S F D V R - - - - - - L S G G - - G K S N S L V H E E H E C L P - - - - - - - - - - - - - V V Q N S R W A S L
pt000710_POPTR_    - - - - - S F E V R - - - - - - L P G H F R G K S H G S A C E L L D Q P V - - - - - - - - - - - - - V I Q D S P W A G L
gm004126_Glyma0    - - - - - G F E V K - - - - - - F G Y S M R S R S Q S H S D A I A Q D S L - - - - - - - - - V V L D G L K Q S C W A N M
Os009471_Os02t0    - - - - - A A D G R - - - - - - - A G G G R G G S R H S W P V L W S E Q Q Q P P Q Q Q Q L Q R Q E H Q Q Q Q G R W A N L
pt000712_POPTR_    - - - - - S F E V R - - - - - - L P G H F R G K S H G S A C E L L D Q P V - - - - - - - - - - - - - V I Q D S P W A G L
gm041730_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - R S Q S Q R - - V V Q E Q E E A E - - - - - - C V G D S M R Q S C W A N M
gm045746_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I - E V Q A N A M E Q S W W A N M
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    - - - - - S F D V R - - - - - - L T G H H R G K S Q G S V Q D L H D Q P L - - - - - - - - - - - - - V I Q N S R W A S L
Os019649_Os04t0    - - - - - S F E V K I S - - - G F S G R H R G K S I G P S S E L D D T P V - - - - - - - - - - - - - V A Q Q S K W A G L
pp022947_Pp1s22    - - - - - S F E L K - - - - - - F P H H H K G R S S G M V L D E S Q L R A E P V - - - - - - - - - - - V E Q S C W A N M
pp034735_Pp1s15    - - - - - S F E L K - - - - - - F P H H H K G R S S G M V L D E S Q L R V E A V - - - - - - - - - - - V K Q S C W A N M
gm045744_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I - E V Q A N A M E Q S W W A N M
gm001764_Glyma0    - - - - - G V E S R - - - - - - - R W N G R T K S - H V A P D V I L T S L E P I Q Q G Q - - - - - - - - - - - - W A N L
pt037558_POPTR_    - - - - - G L E G K - - - - - - - H W R G R A R S - H I A P D E T P A E T D Q I E Q G Q - - - - - - - - - - - - W A N L
Os022386_Os05t0    - G G V G G G E S K - - - V S P E I A P V S G G E G E G - - E E E - - - - - - - - - - - - - - - - - E G E E E R W S R L
gm045745_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M I - E V Q A N A M E Q S W W A N M
pp022942_Pp1s22    - - - - - S F E L K - - - - - - F P H H H K G R S S G M V L D E S Q L R A E P V - - - - - - - - - - - V E Q S C W A N M
Sb028483_Sorbi1    - - - - - G F E V R - - - - - - F L S P R R G K S H G A V H E L H D P V P - - - - - - - - - - - - - V V Q S S C W A S L
Os009468_Os02t0    - - - - - A A D G R - - - - - - - A G G G R G G S R H S W P V L W S E Q Q Q P P Q Q Q Q L Q R Q E H Q Q Q Q G R W A N L
pp034734_Pp1s15    - - - - - S F E L K - - - - - - F P H H H K G R S S G M V L D E S Q L R V E A V - - - - - - - - - - - V K Q S C W A N M
gm028526_Glyma1    - - - - - S F E V R - - - - - - L P G H N R G K S R S L V H E L Q D Q P P - - - - - - - - - - - - - V I Q N S R W A S L
gm054929_Glyma2    - - - - - S F E V R - - - - - - L P G H N R G K S R S S V H E L Q D Q P P - - - - - - - - - - - - - V I Q N S R W A S L
gm034540_Glyma1    G A A V - - - - - - - - - - - - - - - - E G G V A G T V - - E E A - - - - - - - - - - - - - - - - A N G N N N G W S S M
Os021774_Os05t0    - - - - - S F E V T L A G L S G L T G H H R G K S Q S T V H E L C D A D L - - - - - - - - - - - - - I I Q E S R W A S L
Os029803_Os08t0    - - - - - S F E V R I S G L P G L S G H H R G K S L G S L S E L R D R P V - - - - - - - - - - - - - V V D Q S R W V G L
Os022387_Os05t0    - G G V G G G E S K - - - V S P E I A P V S G G E G E G - - E E E - - - - - - - - - - - - - - - - - E G E E E R W S R L
Os022798_Os05t0    - - - - - - - - - - - - - - - - - - - R E E A A V G E G - - E G E - - - - - - - - - - - - - - - - - - - E E G R W G G L
pt039357_POPTR_    - - - - - S F E V R - - - - - - L P G H L R G K S H G S A C E L Q D Q P V - - - - - - - - - - - - - V I Q N S R W A G L
gm028527_Glyma1    - - - - - S F E V R - - - - - - L P G H N R G K S R S L V H E L Q D Q P P - - - - - - - - - - - - - V I Q N S R W A S L
Os029491_Os07t0    - - - - - G F - - - - - - - - - - - - - - R S R P G R V R - R V A A A A E E P P - D E S - S A A A L V M R E S C W T Q L
Os021773_Os05t0    - - - - - S F E V T L A G L S G L T G H H R G K S Q S T V H E L C D A D L - - - - - - - - - - - - - I I Q E S R W A S L
gm019438_Glyma0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M E Q S W R A N M
Os003209_Os01t0    - - - - - - - - - - - - - - - P P P - P E G G E V H E V - V E G E - - - - - - - - - - - - - D G Q A E D Q E E R W A R L
Sb024300_Sorbi1    - - - - - G L - - - - - - - - - - - - - L R F R S G G H A A A A G R A S A A A E P D E - - - - - - - A L R E S C W A R V
gm030080_Glyma1    - - - - - G V E S R - - - - - - - R W N G R T K S - H V A P D V T L T S L E P I Q Q G H - - - - - - - - - - - - W A N L
gm044675_Glyma1    - - - - - G A E S K - - - - - - - H W L S R T K S - H V A P D I L A T P F E P I Q Q G Q - - - - - - - - - - - - W A N L
pt001717_POPTR_    - - - - - K L Q R N - - - - - - - R T N R R G R A - Y I A P E L - - - - - - - - G G G S E L L S E L I E E Q S P W A N L
Sm012016_Selmo1    - - - - - S F E V R - - - - - - L P Y H H R S R S H S V V L D E P P V R D V V V - - - - - - - - - - - L Q Q S R W A S M
Os019651_Os04t0    - - - - - S F E V K I S - - - G F S G R H R G K S I G P S S E L D D T P V - - - - - - - - - - - - - V A Q Q S K W A G L
Sb032884_Sorbi1    L G A A V G G E A K - - - V T P E V D P A A A Q E M E - - - E D E - - - - - - - - - - - - - - - - - E A D E E R W S R L
gm003395_Glyma0    - - - - - S F D V R - - - - - - I S G G - - G K L N S L V H E A H E R Q L - - - - - - - - - - - - - V I Q N S R W A S L
pt002868_POPTR_    - - - - - S F E V R - - - - - - L P G H H R G K S H S S A C E L H D Q P V - - - - - - - - - - - - - V I Q N S R W A G L
Os040209_Os12t0    - - - - - G F E V R - - - - - - L V G H R R G R S H S A V H E L R D G H A A A A - - - - - - - A A D V V Q S S C W A N L
pt037730_POPTR_    - - - - - K L Q R N - - - - - - - R T N R R G R A - Y I A P E L - - - - - - - - G G G S E L F R E L I E E Q S P W A N L
gm003396_Glyma0    - - - - - S F D V R - - - - - - I S G G - - G K L N S L V H E A H E R Q L - - - - - - - - - - - - - V I Q N S R W A S L
gm037352_Glyma1    G A A I V G - - - - - - - - - - - - - G E D G V A G A G - - E E S - - - - - - - - - - - - - - - - S N G - N N G W S N M
Sb025595_Sorbi1    - - - - - - - - - - - - - - A P P P L P E R G E M D E V - V E A D P - - - - - - - - - - - - D A E A E D Q E E R W A R L
pt037559_POPTR_    - - - - - G L E G K - - - - - - - H W R G R A R S - H I A P D E T P A E T D Q I E Q G Q - - - - - - - - - - - - W A N L
pt025486_POPTR_    R N A V - - - - - - - - - - - - - - - - E S G R L G G - - - - - E - - - - - - - - - - - - - - - - L W A E S D G W G S M
pt000711_POPTR_    - - - - - S F E V R - - - - - - L P G H F R G K S H G S A C E L L D Q P V - - - - - - - - - - - - - V I Q D S P W A G L
pt034249_POPTR_    - - - - - - - - - - - - - - - - - - - - - - N R S T S H R - - V V Q Y S S A P E L N L F - A A G G A A E T A S C W A N L
gm021742_Glyma0    - - - - - S F D V R - - - - - - L T G H H R G K S Q G S V Q D L H D Q P L - - - - - - - - - - - - - V I Q N S R W A S L
pt000709_POPTR_    - - - - - S F E V R - - - - - - L P G H F R G K S H G S A C E L L D Q P V - - - - - - - - - - - - - V I Q D S P W A G L
Os004869_Os01t0    - - - - - S F E V T L A S L Y G L T G H H K G K T Q S S L D E L D D S P A - - - - - - - - - - - - - I I P E S R W A S L
gm021740_Glyma0    - - - - - S F D V R - - - - - - L T G H H R G K S Q G S V Q D L H D Q P L - - - - - - - - - - - - - V I Q N S R W A S L
 
AT3G06380.1     P E E L L R E I L I R V E T - V D G G D W P S R R N V V A C A G V C R S W - R I L T K E I V A - V P E F S - - - - - - -
gm054928_Glyma2    P P E L L R D V I N R L E A - S E S T - W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C - - - - - - -
gm003397_Glyma0    P P E L L C D V I K R L E E - S E S T - W P A R K H V V A C A A V C K S W - R E M C K E I V T - S P E F C - - - - - - -
pt028965_POPTR_    L P E L L G E I I K R V E E - S E D R - W P Q R Q N V V A C A C V C K K W - R E V T K D I V K S L P N N N N - - N N G S
gm048089_Glyma1    P P E L L L D I I Q R L E A - S E T S - W P A R R A L V A C A S V C K L W - R E I T K D V V K - T P E Q C - - - - - - -
gm041219_Glyma1    P P E L L F D I I R R L E E - S E N T - W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C - - - - - - -
pp034759_Pp1s15    P P E L L R D V I Q R V E A - S E S A - W P G R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S - - - - - - -
gm021743_Glyma0    P P E L L F D I I R R L E E - S E N T - W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C - - - - - - -
gm030081_Glyma1    P P E L L L D I I R R V E D - S E T T - W P A R A V V V Y C G S V C K S W - R A V T K E I V K - T P E Q C - - - - - - -
pt001281_POPTR_    P P E L L L D I I M R L E E - S E S S - W P A R V V V V H C A S V C R S W - R E I T K E I V K - T P E Q C - - - - - - -
Sm016835_Selmo1    P P E L L R D V I Q R V E A - S D K M - W P S R K S V V A C A A V C R N W - R K I T K E I V Q - T L E Q C - - - - - - -
gm039265_Glyma1    P P E L L L D I I Q R L E A - S E T S - W P A R R A L V A C A S V C R L W - R E I T K D V I K - T P E Q C - - - - - - -
Os003208_Os01t0    L P E L M S E V V R R V E A S G G E R - W P A R K D V V S C A C V C R R W - R D A A V A V V R - P P A E S - - - - - - -
pp005711_Pp1s21    P P E L L R D V I Q R V E A - S E S A - W P S R K H V V A C A A V C S S W - R E V T K E L V R - A P E Q S - - - - - - -
Sb019095_Sorbi1    L P E L L A E V L R R L E A S G G E R - W P A R K D V V S C A C V C R R W - R D V A A T V V R - P L P E S - - - - - - -
gm003133_Glyma0    P S E L L L D I I Q R V E E - S E T S - W P A R A V V V F C A S V C K S W - R S I T R E I V K - T P E Q C - - - - - - -
gm039266_Glyma1    P P E L L L D I I Q R L E A - S E T S - W P A R R A L V A C A S V C R L W - R E I T K D V I K - T P E Q C - - - - - - -
gm044960_Glyma1    P P E L L R D V I K R L E E - S E T T - W P A R K H V V A C A A V C R S W - R G M C K E I V T - S P E F C - - - - - - -
Sb027814_Sorbi1    P P E L L L D V I Q R V E S - S E A T - W P A R R Q V V A C A A V C R S W - R E V T K E V V K - T L E E C - - - - - - -
gm044959_Glyma1    P P E L L R D V I K R L E E - S E T T - W P A R K H V V A C A A V C R S W - R G M C K E I V T - S P E F C - - - - - - -
pt000710_POPTR_    P P E L L R D V I K R L E A - S E S T - W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S - - - - - - -
gm004126_Glyma0    P P E L L R D V L M R I E A - S E D S - W P A Q K H V V A C A G V C R S W - R E I M K E I V K - S P Q L S - - - - - - -
Os009471_Os02t0    P P E L L L D V I Q R V E A - S E A T - W P A R R Q V V A C A A V C R S W - R E V T K E V V K - T L E E C - - - - - - -
pt000712_POPTR_    P P E L L R D V I K R L E A - S E S T - W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S - - - - - - -
gm041730_Glyma1    P Q E L L R E V L F R I E A - S E D A - W P P R K S V V A C A G V C R S W - R Q I T I D I V K - T P E L S - - - - - - -
gm045746_Glyma1    P H E L L R E V L L R I E S - S E S T - W P L R R S V V A C G G V C R T W R R L I V K E I V K - P P Q F S - - - - - - -
gm036752_Glyma1    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    P P E L L F D I I R R L E E - S E N T - W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C - - - - - - -
Os019649_Os04t0    P P E L L R D V M K R L E E - D D S N - W P S R K D V V A C A S V C T T W - R D M C K D I V R - N P E F C - - - - - - -
pp022947_Pp1s22    P P E L L R D V I Q R V E A - S E N A - W P S R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S - - - - - - -
pp034735_Pp1s15    P P E L L R D V I Q R V E A - S E S A - W P G R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S - - - - - - -
gm045744_Glyma1    P H E L L R E V L L R I E S - S E S T - W P L R R S V V A C G G V C R T W R R L I V K E I V K - P P Q F S - - - - - - -
gm001764_Glyma0    P P E L L L D I I R R V E D - S E T T - W P A R A V V V Y C G S V C K S W - R A V T K E I V K - T P E Q C - - - - - - -
pt037558_POPTR_    P P E L L L D I I R R V E E - S E T S - W P A R A V V V H C A S V C R S W - R E I T K E I V K - T P E Q C - - - - - - -
Os022386_Os05t0    L P E L L T E I M R R V D A - G A E R - W P P R R D V V A C A C V C R R W - R D A A V S V V R - P P L E C - - - - - - -
gm045745_Glyma1    P H E L L R E V L L R I E S - S E S T - W P L R R S V V A C G G V C R T W R R L I V K E I V K - P P Q F S - - - - - - -
pp022942_Pp1s22    P P E L L R D V I Q R V E A - S E N A - W P S R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S - - - - - - -
Sb028483_Sorbi1    P P E L L R D V I E R L E T - S E D T - W P S R K H V V A C A A V C R T W - R E M C R E I V K - S P E V S - - - - - - -
Os009468_Os02t0    P P E L L L D V I Q R V E A - S E A T - W P A R R Q V V A C A A V C R S W - R E V T K E V V K - T L E E C - - - - - - -
pp034734_Pp1s15    P P E L L R D V I Q R V E A - S E S A - W P G R K H V V A C A A V C S S W - R E I T K E L V R - T P E Q S - - - - - - -
gm028526_Glyma1    P P E L L R D V I N R L E A - S E S T - W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C - - - - - - -
gm054929_Glyma2    P P E L L R D V I N R L E A - S E S T - W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C - - - - - - -
gm034540_Glyma1    L P E I L G E I V R R V D A - A E E Q - W P N R Q N V V A C A C V C K R W - R D I T R E V V R - V P S H T - - - - - - -
Os021774_Os05t0    P P E L L R D V I R R L E A - S E S T - W P S R K D V V S C A A V C K A W - R E M C K E I V L - S P E F C - - - - - - -
Os029803_Os08t0    P P E L L R D V M K R L E E - G E S N - W P S R K D V V A C A A V C R T W - R E I C K D I V Q - S P E I C - - - - - - -
Os022387_Os05t0    L P E L L T E I M R R V D A - G A E R - W P P R R D V V A C A C V C R R W - R D A A V S V V R - P P L E C - - - - - - -
Os022798_Os05t0    L P E L V E E V V R R V E A S G G E R - W P A R K D L V S C A C V C R R W - R E A A A A V V R - P L P E S - - - - - - -
pt039357_POPTR_    P P E L L Q D V I K R L E A - S E S T - W P S R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S - - - - - - -
gm028527_Glyma1    P P E L L R D V I N R L E A - S E S T - W P G R K H V V A C A A V C K S W - R E M C K E I V S - S P E F C - - - - - - -
Os029491_Os07t0    P P E L L R E V L A R V E E - S E G W - W P R R R D V V A C A G V C R S W - R G I V R E I V R - T P E A S - - - - - - -
Os021773_Os05t0    P P E L L R D V I R R L E A - S E S T - W P S R K D V V S C A A V C K A W - R E M C K E I V L - S P E F C - - - - - - -
gm019438_Glyma0    P R E L L R E V L L R I E S - S E A T - W P S R R S V V A C G G V C R T W - R L I V K E I V K - P P Q L S - - - - - - -
Os003209_Os01t0    L P E L M S E V V R R V E A S G G E R - W P A R K D V V S C A C V C R R W - R D A A V A V V R - P P A E S - - - - - - -
Sb024300_Sorbi1    P P E L L R M V L A R V E H - E E A R - W P G R S A V V A S A G V C R C W - R A V V K E M V R - V P E V S - - - - - - -
gm030080_Glyma1    P P E L L L D I I R R V E D - S E T T - W P A R A V V V Y C G S V C K S W - R A V T K E I V K - T P E Q C - - - - - - -
gm044675_Glyma1    P S E L L L D I I Q R I E E - S E T S - W P A R A V V V F C A S V C K S W - R S I T R E I V K - T P E Q C - - - - - - -
pt001717_POPTR_    P P E L L Q D V I K R V E G - S E T S - W P G R R D V V A C A S V C T S W - R E I T K A V V K - T P E Q C - - - - - - -
Sm012016_Selmo1    P P E L L R D V I Q R L E S - S E H T - W P A R K N V V V C A E V C S Q W - R D I A K E L V K - T P E Q S - - - - - - -
Os019651_Os04t0    P P E L L R D V M K R L E E - D D S N - W P S R K D V V A C A S V C T T W - R D M C K D I V R - N P E F C - - - - - - -
Sb032884_Sorbi1    L P E L L T E I M R R V D A - G A E R - W P P R R D V V V C A C V C R R W - R D A A V S V V R - P P L E C - - - - - - -
gm003395_Glyma0    P P E L L C D V I K R L E E - S E S T - W P A R K H V V A C A A V C K S W - R E M C K E I V T - S P E F C - - - - - - -
pt002868_POPTR_    P P E L L R D V I K R L E A - S E S T - W P A R K H V V A C A A V C S A W - R E M C K E I V R - N P E F S - - - - - - -
Os040209_Os12t0    P P E L L R D V I E R L E A - S E A A - W P S R K N V V A C A A V C R T W - R D M C R E I V K - N P E F C - - - - - - -
pt037730_POPTR_    P P E L L H D V I Q R V E G - S E T S - W P G R R D V V A C A S V C K S W - R E I T K T V V K - T P E Q C - - - - - - -
gm003396_Glyma0    P P E L L C D V I K R L E E - S E S T - W P A R K H V V A C A A V C K S W - R E M C K E I V T - S P E F C - - - - - - -
gm037352_Glyma1    L P E I L G E I V R R V D A - A E E Q - W P N R Q N V V A C A C V C K R W - R D I T R E V V R - V P S H T - - - - - - -
Sb025595_Sorbi1    L P E L L S D V V Q R V E A S G G E R - W P A R K D V V S C A C V C R R W - R E A A V A V V R - P P A E S - - - - - - -
pt037559_POPTR_    P P E L L L D I I R R V E E - S E T S - W P A R A V V V H C A S V C R S W - R E I T K E I V K - T P E Q C - - - - - - -
pt025486_POPTR_    L P E L L G E I I K R V E E - S E D R - W P Q R Q S V V A C A C V C K K W - R D V T K D I V K S L P N S S S S T N N A S
pt000711_POPTR_    P P E L L R D V I K R L E A - S E S T - W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S - - - - - - -
pt034249_POPTR_    P Q E L L R E V L V R I E E - S E S S - W P P R K N V V A C A G V C R S W - R H I T K D L V K - V P E L S - - - - - - -
gm021742_Glyma0    P P E L L F D I I R R L E E - S E N T - W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C - - - - - - -
pt000709_POPTR_    P P E L L R D V I K R L E A - S E S T - W P A R K H V V A C A S V C R A W - R E M C K E I V R - S P E F S - - - - - - -
Os004869_Os01t0    P P E L L R E V I R R L E A - D E S T - W P S R R N V V C F A A V C R T W - R E M C K E T V L - S P E F C - - - - - - -
gm021740_Glyma0    P P E L L F D I I R R L E E - S E N T - W P A R K H V V A C A A V C Q S W - R N M C K D I V K - S P E F C - - - - - - -
 
AT3G06380.1     - S K L T F P I S L K Q S G P R D S L V Q C F I K R N R N T Q S Y H L Y L G L T T S - - - - L - - - - T D N G K F L L A
gm054928_Glyma2    - G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm003397_Glyma0    - G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
pt028965_POPTR_    S G K I T F P S C L K Q P G P R D L P H Q C L I K R N K K T S T F Y L Y L A L T P S - - - - F T - - - - D K G K F L L A
gm048089_Glyma1    - G F I T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A - - - - L S - - - G D M S K L L L A
gm041219_Glyma1    - G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
pp034759_Pp1s15    - G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P T - - - - L - - - - V E N G K F L L A
gm021743_Glyma0    - G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm030081_Glyma1    - G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - - E - - - N E T D K L L L A
pt001281_POPTR_    - G R L T F P I S L K Q P G P R E S P I Q C F I K R D N A T S T F L L Y Y G L V P S - - - - - G - - - G E N D K L L L A
Sm016835_Selmo1    - G R L T F P V S L K Q P G P R D A T V Q C Y L K R D R T T S T Y Y L Y L G I T P S K P S - - - - - - K K N G K F L L A
gm039265_Glyma1    - G L L T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A - - - - L S - - - G D M S K L L L A
Os003208_Os01t0    - G K I T F P S S L K Q P G P R E F P M Q C F I K R N K K N S T F Y L Y L G L T N A - - - - T V - - - - D K G K F L M A
pp005711_Pp1s21    - G R L T F P V A L K Q P G P R E D T V Q C F I K R D R T T S T Y Q L F L G L P P S - - - - Q - - - - - E N G K F L L A
Sb019095_Sorbi1    - G K I T F L A S L K Q P G P K D F P I Q C F I K R N K K N S L F Y L Y L G L T N N - - - - P M M P A T D K G K F L M A
gm003133_Glyma0    - G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y F G L V P S - - - - - E - - - N D S N K L L L A
gm039266_Glyma1    - G L L T F P I S L K Q P G P R D S P I Q C F I R R E R M T S T Y C L Y L G L S P A - - - - L S - - - G D M S K L L L A
gm044960_Glyma1    - G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
Sb027814_Sorbi1    - G R I T F P I S L K Q P G P R D L P V Q C F V R R E R A T S T Y L L Y L G L S P S - - - - M N - - - M E N D K L L L A
gm044959_Glyma1    - G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
pt000710_POPTR_    - G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm004126_Glyma0    - G K L T F P I S L K Q P G P R D S L L Q C Y I K R N R S N Q T Y Y L F L G L N Q A - - - - S - - - - T D E G K F L L S
Os009471_Os02t0    - G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S - - - - L H - - - G E N D K L L L A
pt000712_POPTR_    - G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm041730_Glyma1    - S K I T F P I S V K Q P G P R E N L L R C F I K R N R S S Q T Y Y L Y L S L T N T - - - - L - - - - A E D G K F L L A
gm045746_Glyma1    - S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A - - - - L V - - - A D D G K F L L A
gm036752_Glyma1    - - - - - - - - - - - M P G P R E N L L R C F I K R N R S T Q T Y Y L F L S L T S T - - - - L - - - - A E D G K F L L A
gm021741_Glyma0    - G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
Os019649_Os04t0    - G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A - - - - V L - - - D E T G K F L L S
pp022947_Pp1s22    - G R L T F P I A L K Q P G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S - - - - L - - - - V E N G K F L L A
pp034735_Pp1s15    - G R L T F P I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S - - - - L - - - - V E N G K F L L A
gm045744_Glyma1    - S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A - - - - L V - - - A D D G K F L L A
gm001764_Glyma0    - G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - - E - - - N E T D K L L L A
pt037558_POPTR_    - G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S - - - - - E - - - G E N D K L L L A
Os022386_Os05t0    - G R I T F P S S L K Q P G P R D A P M H C F I R R N K K N S T F Y L Y L S L T Q A - - - - L T - - - - D K G K F L L A
gm045745_Glyma1    - S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A S Q T Y Y L F L S L S S A - - - - L V - - - A D D G K F L L A
pp022942_Pp1s22    - G R L T F P I A L K Q P G P R D S T M Q C F I K R D R T T S T Y Q L F L G L P P S - - - - L - - - - V E N G K F L L A
Sb028483_Sorbi1    - G K I T F P V S L K Q P G P R D G T I Q C F I K R D K S T Q V Y S L Y L S F S S A - - - - V P - - - A E D G K F L L S
Os009468_Os02t0    - G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S - - - - L H - - - G E N D K L L L A
pp034734_Pp1s15    - G R L T F P I A L K Q P G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S - - - - L - - - - V E N G K F L L A
gm028526_Glyma1    - G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L G L S P A - - - - L L - - - V E N G K F L L S
gm054929_Glyma2    - G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm034540_Glyma1    - G K I T F P S C L K Q P G P R D V P H Q C L I K R N Q K T S T F Y L Y L A L T P S - - - - F T - - - - D K G K F L L A
Os021774_Os05t0    - G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A - - - - V L - - - A D S G K F L L S
Os029803_Os08t0    - G K L T F P V S L K Q P G P R D G L I Q C F I K R D K S K L T Y Y L Y L C L S P A - - - - V L - - - S E N G K F L L A
Os022387_Os05t0    - G R I T F P S S L K Q P G P R D A P M H C F I R R N K K N S T F Y L Y L S L T Q A - - - - L T - - - - D K G K F L L A
Os022798_Os05t0    - G R I T F P S S L K Q P G P K D F P I Q C F V K R N K K K S M F Y L Y L G L L N G - - - - T M - - - - D K G K F L M A
pt039357_POPTR_    - G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm028527_Glyma1    - G K I T F P V S L K Q P G H R D G P I Q C F I K R D K S K L T Y H L F L G L S P A - - - - L L - - - V E N G K F L L S
Os029491_Os07t0    - G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - - - - L - - - - T D D G K F L L A
Os021773_Os05t0    - G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A - - - - V L - - - A D S G K F L L S
gm019438_Glyma0    - S N I T F P I S L K Q P G P R E H L L Q C F I R R N S A T Q T Y Y L F L S L S S A - - - - L I - - - A D D G K F L L A
Os003209_Os01t0    - G K I T F P S S L K Q P G P R E F P M Q C F I K R N K K N S T F Y L Y L G L T N A - - - - T V - - - - D K G K F L M A
Sb024300_Sorbi1    - G K I T F P I S L K Q P G P R D A P M K C F I R R N R A T Q S Y S L C I G I T D A - - - - L - - - - A D D G K F L L A
gm030080_Glyma1    - G R L T F P I S L K Q P G P R D S P I Q C F I R R N R E T S T Y L L Y I G L V P S - - - - - E - - - N E T D K L L L A
gm044675_Glyma1    - G R I T F P I S L K Q P G P R D S P I Q C F I R R N K E T S T Y L L Y F G L V P S - - - - - E - - - N D G N K L L L A
pt001717_POPTR_    - G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y H L Y L G L S P A - - - - L S - - - G D M S K L L L A
Sm012016_Selmo1    - G K L T F P I S L K Q P G P R D A T M Q C F I K R D R A T S T Y H L C L G L S P N F D A G L - - - - Q E H G K F L L A
Os019651_Os04t0    - G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A - - - - V L - - - D E T G K F L L S
Sb032884_Sorbi1    - G R I T F P S S L K Q P G P R D A P M H C F I R R D K K N S T F S L Y L S L T Q A - - - - L T - - - - D K G K F L L A
gm003395_Glyma0    - G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
pt002868_POPTR_    - G K I T F P V S L K Q P G P R D G T I Q C F I K R D K S K L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
Os040209_Os12t0    - G K I T F P V S L K Q P G P R N G A I Q C F I K R D K S T Q T Y N L Y L C L S S A - - - - V L - - - V E S G K F L L S
pt037730_POPTR_    - G C I T F P I S L K Q P G P R D A P I Q C F I K R E R A T S T Y L L Y L G L S P A - - - - L S - - - G D M N K V L L A
gm003396_Glyma0    - G K I T F P V S L K Q P G S R D G T I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
gm037352_Glyma1    - G K I T F P A C L K Q P G P R D V P H Q C L I K R N K K T S T F Y L Y L A L T P S - - - - F T - - - - D K G K F L L A
Sb025595_Sorbi1    - G K I T F P S S L K Q P G P R E S P M Q C F I K R N K K N S T F Y L Y L G F T S S - - - - P V - - - - D K G K F L M A
pt037559_POPTR_    - G R L T F P I S L K Q P G H R E S P I Q C F I K R D T A T S T F L L Y Y G L V P S - - - - - E - - - G E N D K L L L A
pt025486_POPTR_    P G K I T F P S C L K Q P G P R D L P H Q C L I K R N K K T S T F Y L Y L A L T P S - - - - F M - - - - D K G K F L L A
pt000711_POPTR_    - G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
pt034249_POPTR_    - G K I T F P I S V K Q P G P R E Q L L Q C F I K R C R S T Q T Y R L Y L S L N N A - - - - L - - - - T E D G K F L L A
gm021742_Glyma0    - G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
pt000709_POPTR_    - G K I T F P V S L K Q P G P R D G T V Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
Os004869_Os01t0    - G K L T F P V S I K Q P G P R D G M I Q C Y I K R N R S K S T Y H L Y L C L S N V - - - - V T - - - A E G G K F V L A
gm021740_Glyma0    - G K L T F P V S L K Q P G P R D G I I Q C F I K R D K S N L T Y H L F L C L S P A - - - - L L - - - V E N G K F L L S
 
AT3G06380.1     A S K L K R A T C T D Y I I S L R S D D I S K R S - - N A Y L G R M - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054928_Glyma2    A K R T R R T T C T E Y I I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003397_Glyma0    A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt028965_POPTR_    A R R Y R Q G V H T E Y I I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm048089_Glyma1    A K K I R R A T C T E F I I S L V S D D F S W A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041219_Glyma1    A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034759_Pp1s15    A K K F R R P T R T D Y I I S L N H D D M S R G G - - T A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021743_Glyma0    A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030081_Glyma1    A K K V R R A T G T D F I I S L V A D D F S R S S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001281_POPTR_    A R K I R R A T C T D F I V S L V S D D F S R A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm016835_Selmo1    A R K F R R A S G T D Y I I S T D T D D F S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039265_Glyma1    A K K I R R A T C T E F I I S L V A D D F S R A C - - D T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os003208_Os01t0    A R R F R R G P H T E Y I V S L D A D D L S Q G S - - N A Y M G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pp005711_Pp1s21    A Q K F R R A T S T D Y I I S L N Q E D M S R G S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb019095_Sorbi1    A K R F R R G A P T E Y I I S L D A D D I S Q G N - - K A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003133_Glyma0    A K R I R R A T G T G F V I S L A A D D F S R A S - - N K Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm039266_Glyma1    A K K I R R A T C T E F I I S L V A D D F S R A C - - D T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044960_Glyma1    A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb027814_Sorbi1    A R K V R R A T R T S F V I S L V S D D F S H S S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044959_Glyma1    A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000710_POPTR_    A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm004126_Glyma0    A R K C R R A T H T D Y I I S L N C D D V S R G S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os009471_Os02t0    A R K I R R A T R T S F V I S L V S N D F S L S S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000712_POPTR_    A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm041730_Glyma1    A R K C R R P T C T D Y I I S L D A D D M S K G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045746_Glyma1    A R K F R R P T C T D Y I I S L D A D D M S R E S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm036752_Glyma1    A R K C R R P T C T D Y I I S L D A D D M S K G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021741_Glyma0    A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019649_Os04t0    A K R S R R T T H T D Y I I S M D S K N I S R S S - - S G Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022947_Pp1s22    A R K F R R A T S T D Y I I S L N Q E N M S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034735_Pp1s15    A R K F R R A A S T D Y I I S L N Q E D I S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045744_Glyma1    A R K F R R P T C T D Y I I S L D A D D M S R E S - - N A Y V G K L R S T L N Q I L L L A I L L F L F L S A K T N P L S
gm001764_Glyma0    A K K V R R A T G T D F V I S L V A D D F F R S S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037558_POPTR_    A R K I R R A T C S D F I V S L V S D D F S R A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022386_Os05t0    A R R F R N G A H T E Y I I S Y D C D D L F P G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm045745_Glyma1    A R K F R R P T C T D Y I I S L D A D D M S R E S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pp022942_Pp1s22    A R K C R R A T S T D Y I V S L N H E D M S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb028483_Sorbi1    A K R N C R P T Y T E Y T I S I N S G D I S R S T S N N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os009468_Os02t0    A R K I R R A T R T S F V I S L V S N D F S L S S - - S T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034734_Pp1s15    A R K F R R A A S T D Y I I S L N Q E D I S R G S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028526_Glyma1    A K R T R R T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm054929_Glyma2    A K R T R R T T C T E Y I I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm034540_Glyma1    A R R Y R C G T H T E Y I I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os021774_Os05t0    A K R H R K T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029803_Os08t0    A K R N R R A T S T E Y I I S V D S K N I S R S S - - N G Y V G K M - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022387_Os05t0    A R R F R N G A H T E Y I I S Y D C D D L F P G S - - N S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os022798_Os05t0    A R R F R R G P H T E Y V I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt039357_POPTR_    A K R K R R T A C T E Y V I S M D A D N V S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm028527_Glyma1    A K R T R R T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os029491_Os07t0    A R K C R R T T C T E Y L I S L D M N D I S K R T - - D S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os021773_Os05t0    A K R H R K T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm019438_Glyma0    A R K F R R P T C I D Y I I S L D A D D M S R E S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os003209_Os01t0    A R R F R R G P H T E Y I V S L D A D D L S Q G S - - N A Y M G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb024300_Sorbi1    A R R S R R P A G T E Y L I S L D A K N T S K G - - - - T C I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm030080_Glyma1    A K K V R R A T G T D F I I S L V A D D F S R S S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm044675_Glyma1    A K R I R R A T G T D F I I S L A A D D F S R A S - - N K Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt001717_POPTR_    A K K I R K A T S T D F R I S F V G S D F C Q T S - - N T Y A G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sm012016_Selmo1    A R K V R R A T T T D Y I I S L D P E D F S R G S - - T S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os019651_Os04t0    A K R S R R T T H T D Y I I S M D S K N I S R S S - - S G Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb032884_Sorbi1    A R R F R Q G A H T E Y I I S Y D Y D D L H P R S - - S S Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003395_Glyma0    A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt002868_POPTR_    A K R T R R T T C T E Y V I S M D A D N I S R S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os040209_Os12t0    A K R Y S R A T C T E Y T I F M S A D N T S R S S - - N M Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037730_POPTR_    A K K I R K A T S T D F R I S F A G S D F C Q T S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm003396_Glyma0    A K R T R R T T C T E Y I I S M D A D N I S R S N - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm037352_Glyma1    A R R Y R C G T H T E Y I I S L D A D D L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Sb025595_Sorbi1    A R R F R R G P H T E Y I I S L D S E D L S Q G S - - N A Y M G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt037559_POPTR_    A R K I R R A T C S D F I V S L V S D D F S R A S - - N T Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt025486_POPTR_    A R R Y R Q G A H T E Y I I S L D A D E L S Q G S - - N A Y V G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000711_POPTR_    A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt034249_POPTR_    A R K C R R P T C T D Y I I S L D T D D M S K G S - - N T Y A G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021742_Glyma0    A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
pt000709_POPTR_    A K R S R R T T C T E Y V I S M D A D N I S K S S - - S T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
Os004869_Os01t0    A K R H R K T T C T E Y T I S M V S G N I S R S S - - R T N I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
gm021740_Glyma0    A K R T R R T T Y T E Y V I S M D A D N I S R S S - - N T Y I G K L - - - - - - - - - - - - - - - - - - - - - - - - - -
 
AT3G06380.1     - - - - R S N F L G T K F T V F D - - - - - - G S Q T G A A K M - Q - - - - - - K S R S - S N F I K - V S - - P - R V -
gm054928_Glyma2    - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - - - - - - - R S R R - F - S K K - V S - - P - K V -
gm003397_Glyma0    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
pt028965_POPTR_    - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S S - - - R - - - - - - A S R R - F A S K Q - I S - - P - Q V -
gm048089_Glyma1    - - - - R S N F L G T K F T I L D G E P A H E T S L P L - - N C - K - - - - - - L Q Q R - V H L K Q - V L - - P N K V A
gm041219_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y S S A H I C P P G T G K - - - - - - T S R R - F Y S K K - V S - - P - K V -
pp034759_Pp1s15    - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S N - - - - R - - - - - - G A W R - M G T K Q - L S - - S - R V -
gm021743_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K - - - - - - T S R R - F Y S K K - V S - - P - K V -
gm030081_Glyma1    - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P - - D S - Q - - - - - - P S R R - F H S K Q - V S - - P - R V -
pt001281_POPTR_    - - - - R S N F L G T K F T M Y D S E P T F E V P R Q L - - A S - R - - - - - - T S R R - F N P R Q - V S - - L - R L -
Sm016835_Selmo1    - - - - R S N F M G T K F T L Y D S N P P H D G A V A S T N - - - R - - - - - - A G R R - I L S K Q - V S - - P - R V -
gm039265_Glyma1    - - - - R S N F L G T K F T I L D G E P P H D S S L P L - - N C - K - - - - - - L Q Q R - V H L K Q - V L - - P N K V -
Os003208_Os01t0    - - - - R S D F W G T N F K I Y D S K P P Y D G A K A S S S - - - R - - - - - - S S R R - F G S R R - I S - - P - Q V -
pp005711_Pp1s21    - - - - R S N F L G T K F T I Y D S Q P P Q N G P V L S N - - - - R - - - - - - S S R R - L T S K Q - L S - - Y - R A -
Sb019095_Sorbi1    - - - - R S D F L G T N F K I Y D S Q P P Y D G A K A S S T - - - R - - - - - - S I R R - F G S R R - I S - - P - Q V -
gm003133_Glyma0    - - - - R S N F L G T K F T V Y D S Q A P H D S A I Q S - - N C - Q - - - - - - S S R R - F H S K Q - V S - - P - R V -
gm039266_Glyma1    - - - - R S N F L G T K F T I L D G E P P H D S S L P L - - N C - K - - - - - - L Q Q R - V H L K Q - V L - - P N K V -
gm044960_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
Sb027814_Sorbi1    - - - - K P N F L G T K F T I F D S Q P P P D A V V L P - - N N - K - - - - - - P S K R - - Q S K Q - V S - - P - R L -
gm044959_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
pt000710_POPTR_    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
gm004126_Glyma0    - - - - R S N F L G T K F T V Y D A H P P I Y G A K V T K S - - - R - - - - - - S T R L - V S L K Q - V S - - P - R V -
Os009471_Os02t0    - - - - K P N F L G T K F T I F D S Q P P C D A V V L P - - N N - R - - - - - - P S K R - - H F K Q - V S - - P - R L -
pt000712_POPTR_    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
gm041730_Glyma1    - - - - R S N F L G T K F T I Y D G Q P P H A G A K I M K S - - - R - - - - - - S T R L - V N L K Q - V S - - P - K V -
gm045746_Glyma1    - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K S - - - C - - - - - - S T E L V V N S K Q - V S P R P - R V -
gm036752_Glyma1    - - - - R S N F L G T K F T I Y D S Q L P H T G A K I M K S - - - R - - - - - - S T R L - V N L K Q - V S - - P - K V -
gm021741_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K - - - - - - T S R R - F Y S K K - V S - - P - K V -
Os019649_Os04t0    - - - - R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E - - R - - - - - - T S R R - F S S R K - V S - - P - K V -
pp022947_Pp1s22    - - - - R S N F L G T K F T I Y D S Q P P H S G V V A S N - - - - R - - - - - - G T R R - M G S K Q - L T - - S - R V -
pp034735_Pp1s15    - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S N - - - - R - - - - - - G A W R - M G T K Q - L S - - S - R V -
gm045744_Glyma1    S H F I R S N F L G T K F T I Y D - - - - - - - - - - R K S - - - C - - - - - - S T E L V V N S K Q - V S P R P - R V -
gm001764_Glyma0    - - - - R S N F L G T K F T I Y D S Q P P Q G A A I Q P - - D N - R - - - - - - S S R R - F H S K Q - V S - - P - R V -
pt037558_POPTR_    - - - - R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A N - R - - - - - - I S R R - F H S R Q - V S - - P - R L -
Os022386_Os05t0    - - - - R S D F L G T K F I I Y D S Q P P Y D G A K P S R S - - - Q - - - - - - S S R R - F A S K Q - I N - - P - N V -
gm045745_Glyma1    - - - - R S N F L G T K F T I Y D - - - - - - - - - - R K S - - - C - - - - - - S T E L V V N S K Q - V S P R P - R V -
pp022942_Pp1s22    - - - - R S N F L G T K F T I Y D S Q P P H S G V V A S N - - - - R - - - - - - G T R R - L G S K Q - L T - - S - R V -
Sb028483_Sorbi1    - - - - R S N F L G T K F V I Y D T Q P P Y N A T S P T V A G - - K - - - - - - T N Q R - F Y S K K G G S - - T - K G -
Os009468_Os02t0    - - - - K P N F L G T K F T I F D S Q P P C D A V V L P - - N N - R - - - - - - P S K R - - H F K Q - V S - - P - R L -
pp034734_Pp1s15    - - - - R S N F L G T K F T I Y D S Q P S H N G V A A S N - - - - R - - - - - - G A W R - M G T K Q - L S - - S - R V -
gm028526_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - - - - - - - R S R R - F - S K K - V S - - P - K V -
gm054929_Glyma2    - - - - R S N F L G T K F I I Y D T Q P P Y H N A M L S P P G - - - - - - - - - R S R R - F - S K K - V S - - P - K V -
gm034540_Glyma1    - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S G - - - R - - - - - - A S R R - F A S K Q - I S - - P - Q V -
Os021774_Os05t0    - - - - R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R - - - - - - S S R R - F N S K K - V S - - P - K M -
Os029803_Os08t0    - - - - R S N F L G T K F V V Y D T Q P P Y N A G S L M S C Q - - H - - - - - - G S R R - I S S R R - V S - - P - K L -
Os022387_Os05t0    - - - - R S D F L G T K F I I Y D S Q P P Y D G A K P S R S - - - Q - - - - - - S S R R - F A S K Q - I N - - P - N V -
Os022798_Os05t0    - - - - R S D F W G T N F K I Y D N Q P P Y D D A K T S S T - - - R S S Q R F G S T H R - F G S R R - I C - - P - Q I -
pt039357_POPTR_    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
gm028527_Glyma1    - - - - R S N F L G T K F I I Y D T Q P P Y N N A M L S P P G - - - - - - - - - R S R R - F - S K K - V S - - P - K V -
Os029491_Os07t0    - - - - R S N F L G T K F T I Y D A H P P Y A G D V I S K G - - - Q - - - - - - S A R V - I G S N H - L S - - P - R I -
Os021773_Os05t0    - - - - R S N F L G T K F I I Y D T Q P S Y N G A V I P P V G - - R - - - - - - S S R R - F N S K K - V S - - P - K M -
gm019438_Glyma0    - - - - R S N F L G T K F T I Y D I P L P H V G A K M T K S - - - C - - - - - - F T K L - V N P K Q - V S - - P - R V -
Os003209_Os01t0    - - - - R S D F W G T N F K I Y D S K P P Y D G A K A S S S - - - R - - - - - - S S R R - F G S R R - I S - - P - Q V -
Sb024300_Sorbi1    - - - - R S N F L G T K F T V Y D A H P P C T G A V V S K G - - - P - - - - - - S A H M - I G S A Q - V S - - P - G V -
gm030080_Glyma1    - - - - R S N F L G T K F T I Y D S Q P P H G A A I Q P - - D S - Q - - - - - - P S R R - F H S K Q - V S - - P - R V -
gm044675_Glyma1    - - - - R S N F L G T K F T I F D S Q A P N D V A I Q P - - N C - Q - - - - - - S S R R - F H S K Q - V S - - P - R L -
pt001717_POPTR_    - - - - R S N F L G T K F T I Y D S Q P P C P G L K S - - - N C - K - - - - - - L Q Q K - V R S I Q - V S - - P - G V -
Sm012016_Selmo1    - - - - R S N F L G T K F T I Y D S Q P P H V G A M P S N S - - - R - - - - - - V G R R - F G S K Q - I S - - P - R V -
Os019651_Os04t0    - - - - R S N F L G T K F I I Y D T Q P P Y N A R T L C S Q E - - R - - - - - - T S R R - F S S R K - V S - - P - K V -
Sb032884_Sorbi1    - - - - R S D F L G T K F I I Y D S Q A P Y D G A K P S R S - - - R - - - - - - S T R R - F A S K Q - I S - - P - Q V -
gm003395_Glyma0    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
pt002868_POPTR_    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
Os040209_Os12t0    - - - - R S N L L G T K F V I Y D T Q P P C N T A N V S Q S G - - K - - - - - - T S R R - F Y S R K - V S - - P - K N -
pt037730_POPTR_    - - - - R S N F L G T K F T I Y D G Q T P C P A M R S - - - N C - K - - - - - - P Q R K - V R S I Q - V S - - P - G V -
gm003396_Glyma0    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L S P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
gm037352_Glyma1    - - - - S S D F L G T N F T I Y D S Q P P H S G A K P S S G - - - R - - - - - - A S R R - F A S K Q - I S - - P - Q V -
Sb025595_Sorbi1    - - - - R S D F W G T N F K I Y D S K P P Y D G A K A S S S - - - R - - - - - - S S R R - F G S R R - I S - - P - Q V -
pt037559_POPTR_    - - - - R S N F L G T K F T M Y D C E P T F E V P T Q T Q H A N - R - - - - - - I S R R - F H S R Q - V S - - P - R L -
pt025486_POPTR_    - - - - S S D F L G T N F T I F D S Q P P H S G A K P S S S - - - R - - - - - - A S R R - F A S K Q - I S - - P - Q V -
pt000711_POPTR_    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
pt034249_POPTR_    - - - - R S N F L G T K F T V F D G Q P P H A G A K M T K S - - - Y - - - - - - S S R L - V N L K Q - V S - - P - R V -
gm021742_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K - - - - - - T S R R - F Y S K K - V S - - P - K V -
pt000709_POPTR_    - - - - R S N F L G T K F I I Y D T Q P P Y N N A Q L A P P G - - - - - - - - - R S R R - F Y S K K - V S - - P - K V -
Os004869_Os01t0    - - - - R S N F L G T K F I I Y D T Q P P Y N G A V V P H V G - - R - - - - - - T S K R - F N S T K - V S - - P - K V -
gm021740_Glyma0    - - - - R S N F L G T R F I I C D T Q P P Y S S A H I C P P M T G K - - - - - - T S R R - F Y S K K - V S - - P - K V -
 
AT3G06380.1     P Q G S Y P I A H I S Y E L N V L G S R G P - - - - - - R R M R C I M D T I P M S I V E S R G V - - - - - - - - - - - V
gm054928_Glyma2    P S G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M N C T M Y S I P A S S M E P N G I - - - V P G Q P E - L L
gm003397_Glyma0    P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E - L L
pt028965_POPTR_    P A G N F E V G Q V S Y K F N L L K S R G P - - - - - - R R M V C S L K - - - - - - - - - - - - - - - C P V S Q - - - -
gm048089_Glyma1    A A A N Y K V A T R S K A N A V Y D A L N P H I C N P R R R E R - - - - - - - - - - - - - - - - - - - - - - P Y S - - F
gm041219_Glyma1    P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E - L L
pp034759_Pp1s15    H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A M E S G G S - - - A P T P T E - - L
gm021743_Glyma0    P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E - L L
gm030081_Glyma1    P A C N Y V V S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I P V S A V Q A G G N - - - A P T P T - - - F
pt001281_POPTR_    P A C N Y C I A T I T Y E L N V L R S R G P - - - - - - R R M H C I M H S I P M S S I E E G G T - - - V Q T L T S - - I
Sm016835_Selmo1    P A G S Y N I A H I A Y E L N V L G T R G P - - - - - - R R M E C T I H S I P A S A M E P G G C - - - A P T P L E - - -
gm039265_Glyma1    S A A N Y K V A T V S Y E L N V L R T R G P - - - - - - R R M R C M M H L I P I S A I Q E G G N - - - A P T P L K - - F
Os003208_Os01t0    S A G N Y E V G Q V S Y K Y N L L K S R G P - - - - - - R R M Y C A L E - - - - - - - - - - - - - - - C P S T Q - - - -
pp005711_Pp1s21    H A G S F N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H G I P L S T M E S V G S - - - A P S P T E - - V
Sb019095_Sorbi1    S S G N F D V G Q V S Y K Y N L L K S R G P - - - - - - R R M L C T M E - - - - - - - - - - - - - - - C P S V Q - - - -
gm003133_Glyma0    P A C S Y L V S T V S Y E L N V L C T R G P - - - - - - R R M H C V M N S I P V S A I Q E G G N - - - A P T P T S - - F
gm039266_Glyma1    S A A N Y K V A T V S Y E L N V L R T R G P - - - - - - R R M R C M M H L I P I S A I Q E G G N - - - A P T P L K - - F
gm044960_Glyma1    P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E - L L
Sb027814_Sorbi1    P L G N Y N V A T V T Y E L T V L R N R G P - - - - - - R R M Q C T M H S I P A E C I Q E G G K - - - A P T P T G - - T
gm044959_Glyma1    P S G S Y N I A Q I T Y E L N V L G T R G P - - - - - - R R M N C T M H S I P M S A L E P G C T - - - V P G Q P E - L L
pt000710_POPTR_    P T G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P V S S L E P G G S - - - V P G Q P E - L L
gm004126_Glyma0    P A G N Y P I A H V S Y D L N V L G S R G P - - - - - - R I M Q C V M D A I P A S A V E P G G V - - - A P T Q T Q - - F
Os009471_Os02t0    P L G N Y N V A T V S Y E L T V L R N R G P - - - - - - R R M Q C T M H S I P A L C I Q E G G K - - - A P T P T G - - I
pt000712_POPTR_    P T G S Y N I A H V T Y E L N V L G T R G P - - - - - - R R M H C T M H S I P V S S L E P G G S - - - V P G Q P E - L L
gm041730_Glyma1    P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A A A I E P G G V - - - A P V Q T E - - F
gm045746_Glyma1    P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V A A P S Q T D - - F
gm036752_Glyma1    P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D S I P A T A I E P G G V - - - A P T Q T E - - F
gm021741_Glyma0    P S G S Y N I A Q V T Y E L N V L G T R G P - - - - - - R K M H C V M H S I P A S A L D A G G T - - - V P G Q P E - L L
Os019649_Os04t0    P T G C Y P I V Q V N Y E L N V L G T R G P - - - - - - R R M Q C A M H S I P A S A V E P G G I - - - V P G Q P K E L L
pp022947_Pp1s22    H C G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T M H S I P A S A M A S G G S - - - A P T P T E - - F
pp034735_Pp1s15    H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A M E S G G S - - - A P T P T E - - L
gm045744_Glyma1    P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V A A P S Q T D - - F
gm001764_Glyma0    P A C N Y V V S T I A Y E L N V L R A R G P - - - - - - R R M H C T M N S I S V S A V Q E G G N - - - A P T P T S - - F
pt037558_POPTR_    P A C N Y S I G T I T Y E L N V L R S R G P - - - - - - R R M H C M M H S I P M S S I E E G G T - - - V P T L T S - - L
Os022386_Os05t0    S G G N Y E V G Q V S Y K F N F L K S R G P - - - - - - R R M Q C N I Q - - - - - - - - - - - - - - - C P V G Q - - - -
gm045745_Glyma1    P T G N Y P V A H I S Y E L N V L G S R G P - - - - - - R R M H C V M D T I P A S A I E P G G V A V A A P S Q T D - - F
pp022942_Pp1s22    H C G S H N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T M H S I P A S A M A S G G S - - - A P T P T E - - F
Sb028483_Sorbi1    S C S R Y S I G Q V S Y E L N V L G T R G P - - - - - - R R M N C V M H S I P A S C L E A G G S - - - V P C Q P D S I V
Os009468_Os02t0    P L G N Y N V A T V S Y E L T V L R N R G P - - - - - - R R M Q C T M H S I P A L C I Q E G G K - - - A P T P T G - - I
pp034734_Pp1s15    H S G S Y N V A H I A Y E L N V L G T R G P - - - - - - R R M Q C T L H S I P A C A M E S G G S - - - A P T P T E - - L
gm028526_Glyma1    P S G S Y N I A Q V T Y E L N V