fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT3G06380.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Pp034735 not found in 483aa AT2G47900.2 not_not 0.520923520 III
Pp034734 not found in 483aa AT2G47900.2 not_not 0.520923520 III
Pp034759 not found in 428aa AT2G47900.2 not_not 0.513708513 III
Pp005711 not found in 407aa AT2G47900.2 not_not 0.510822510 III
Pp022942 not found in 447aa AT2G47900.2 not_not 0.510822510 III
Pp022947 not found in 435aa AT2G47900.2 not_not 0.509379509 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT3G06380.1     -------------------------------------------------------MTFRS
pp034735_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRSGSSMMPLKS
pp022942_Pp1s22 -------------------------------------------------------MPLKS
pp034734_Pp1s15 MVANGCLAVRGVRGWMLVWVILVKRALKRISCGVSGSGFRVCRWGMSGRRSGSSMMPLKS
pp005711_Pp1s21 ------------------------------------------------------------
pp034759_Pp1s15 -------------------------------------------------------MPLKS
pp022947_Pp1s22 ------------------------------------------------------------
                                                                            

AT3G06380.1     LL---QEMR------SR-------PHRVVHAAASTANSSDPFS-----------WSELPE
pp034735_Pp1s15 LIREFQEMKGGRGGISRRSFELKFPHH--HKGRSSGMVLDESQLRVEAVVKQSCWANMPP
pp022942_Pp1s22 LIREFQEMKGGIGNISRRSFELKFPHH--HKGRSSGMVLDESQLRAEPVVEQSCWANMPP
pp034734_Pp1s15 LIREFQEMKGGRGGISRRSFELKFPHH--HKGRSSGMVLDESQLRVEAVVKQSCWANMPP
pp005711_Pp1s21 -------MKSGVGRISRRSFELKFPHH--HRGRSSGMVLDESQLNSEPVVEQSCWANMPP
pp034759_Pp1s15 LIREFQEMKGGRGGISRRSFELKFPHH--HKGRSSGMVLDESQLRVEAVVKQSCWANMPP
pp022947_Pp1s22 -------MKGGIGNISRRSFELKFPHH--HKGRSSGMVLDESQLRAEPVVEQSCWANMPP
                       *:      **       **:  * . *:.   *  .           *:::* 

AT3G06380.1     ELLREILIRVETVDGGDWPSRRNVVACAGVCRSWRILTKEIVAVPEFSSKLTFPISLKQS
pp034735_Pp1s15 ELLRDVIQRVEASESA-WPGRKHVVACAAVCSSWREITKELVRTPEQSGRLTFPIALKQP
pp022942_Pp1s22 ELLRDVIQRVEASENA-WPSRKHVVACAAVCSSWREITKELVRTPEQSGRLTFPIALKQP
pp034734_Pp1s15 ELLRDVIQRVEASESA-WPGRKHVVACAAVCSSWREITKELVRTPEQSGRLTFPIALKQP
pp005711_Pp1s21 ELLRDVIQRVEASESA-WPSRKHVVACAAVCSSWREVTKELVRAPEQSGRLTFPVALKQP
pp034759_Pp1s15 ELLRDVIQRVEASESA-WPGRKHVVACAAVCSSWREITKELVRTPEQSGRLTFPIALKQP
pp022947_Pp1s22 ELLRDVIQRVEASENA-WPSRKHVVACAAVCSSWREITKELVRTPEQSGRLTFPIALKQP
                ****::: ***: :.. **.*::*****.** *** :***:* .** *.:****::***.

AT3G06380.1     GPRDSLVQCFIKRNRNTQSYHLYLGLTTSLTDNGKFLLAASKLKRATCTDYIISLRSDDI
pp034735_Pp1s15 GPRESTVQCFIKRDRTSSTYQLYLGLPPSLVENGKFLLAARKFRRAASTDYIISLNQEDI
pp022942_Pp1s22 GPRDSTMQCFIKRDRTTSTYQLFLGLPPSLVENGKFLLAARKCRRATSTDYIVSLNHEDM
pp034734_Pp1s15 GPRESTVQCFIKRDRTSSTYQLYLGLPPSLVENGKFLLAARKFRRAASTDYIISLNQEDI
pp005711_Pp1s21 GPREDTVQCFIKRDRTTSTYQLFLGLPPSQ-ENGKFLLAAQKFRRATSTDYIISLNQEDM
pp034759_Pp1s15 GPRENTVQCFIKRDRTTSTYQLFLGLPPTLVENGKFLLAAKKFRRPTRTDYIISLNHDDM
pp022947_Pp1s22 GPRENTVQCFIKRDRTTSTYQLFLGLPPSLVENGKFLLAARKFRRATSTDYIISLNQENM
                ***:. :******:*.:.:*:*:***..:  :******** * :*.: ****:**. :::

AT3G06380.1     SKRSNAYLGRMRSNFLGTKFTVFDGSQTGAAKMQKSRSSNFI---KVSPRVPQGSYPIAH
pp034735_Pp1s15 SRGSNTYVGKLRSNFLGTKFTIYDSQPSHNGVAASNRGAWRMGTKQLSSRVHSGSYNVAH
pp022942_Pp1s22 SRGSNTYVGKLRSNFLGTKFTIYDSQPPHSGVVASNRGTRRLGSKQLTSRVHCGSHNVAH
pp034734_Pp1s15 SRGSNTYVGKLRSNFLGTKFTIYDSQPSHNGVAASNRGAWRMGTKQLSSRVHSGSYNVAH
pp005711_Pp1s21 SRGSSTYVGKLRSNFLGTKFTIYDSQPPQNGPVLSNRSSRRLTSKQLSYRAHAGSFNVAH
pp034759_Pp1s15 SRGGTAYVGKLRSNFLGTKFTIYDSQPSHNGVAASNRGAWRMGTKQLSSRVHSGSYNVAH
pp022947_Pp1s22 SRGSNTYVGKLRSNFLGTKFTIYDSQPPHSGVVASNRGTRRMGSKQLTSRVHCGSYNVAH
                *: ..:*:*::**********::*.. .  .   ..*.:  :   ::: *.  **. :**

AT3G06380.1     ISYELNVLGSRGPRRMRCIMDTIPMSIVESRGVVASTS-----------ISSFSSRSSPV
pp034735_Pp1s15 IAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTELAAGSLEEVHVPYSSIMSSP-
pp022942_Pp1s22 IAYELNVLGTRGPRRMQCTMHSIPASAMASGGSAPTPTEFTSCGLEEAHVPYSSILLSP-
pp034734_Pp1s15 IAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTELAAGSLEEVHVPYSSIMSSP-
pp005711_Pp1s21 IAYELNVLGTRGPRRMQCTLHGIPLSTMESVGSAPSPTEVTADSLERAHVPHSGVMSSS-
pp034759_Pp1s15 IAYELNVLGTRGPRRMQCTLHSIPACAMESGGSAPTPTELAAGSLEEVHVPYSSIMSSP-
pp022947_Pp1s22 IAYELNVLGTRGPRRMQCTMHSIPASAMASGGSAPTPTEFTSCGLEEAHVPYSSILLSP-
                *:*******:******:* :. ** . : * * ..:.:           :.  .   *. 

AT3G06380.1     FRSHSKPLRSNSASCSD--SGNNLGDPPLVLSNKAPRWHEQLRCWCLNFHGRVTVASVKN
pp034735_Pp1s15 -RSKAAVVDSSALESSEFVSGLLNKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKN
pp022942_Pp1s22 -RSKAAVVDSSALESSELVSGVLCKEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKN
pp034734_Pp1s15 -RSKAAVVDSSALESSEFVSGLLNKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKN
pp005711_Pp1s21 -RSKAAVVDISTLD-YDFASGLLAKDEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKN
pp034759_Pp1s15 -RSKAAVVDSSALESSEFVSGLLNKEEPLVLRNKAPRWHEQLQCWCLNFRGRVTVASVKN
pp022947_Pp1s22 -RSKAAVVDSSALESSELVSGVLCKEEPLVLKNKAPRWHEQLQCWCLNFRGRVTVASVKN
                 **::  :  .: .  :  **    : **** **********:******:**********

AT3G06380.1     FQLVAV-----------------------------SDCEAGQTSERIILQFGKVGKDMFT
pp034735_Pp1s15 FQLVAA------TSVKAVSAAATT-------------SSSSADHDKVLLQFGKIGKDMFT
pp022942_Pp1s22 FQLVAATTSSTTTSTTAGEAAAATGGGGGAGAATPAPTSSGSDHDKVLLQFGKIGKDMFT
pp034734_Pp1s15 FQLVAA------TSVKAVSAAATT-------------SSSSADHDKVLLQFGKIGKDMFT
pp005711_Pp1s21 FQLVASMES--------------------------LPTSSQSDRDKVLLQFGKIGKDIFT
pp034759_Pp1s15 FQLVAA------TSVKAVSAAATT-------------SSSSADHDKVLLQFGKIGKDMFT
pp022947_Pp1s22 FQLVAATTSSTTTSTTAGEAAAATGGGGGAGAATPAPTSSGSDHDKVLLQFGKIGKDMFT
                *****                                 .:    ::::*****:***:**

AT3G06380.1     MDYGYPISAFQAFAICLSSFETRIACE
pp034735_Pp1s15 MDYRYPLSAFQAFAICLSSFDTKLACE
pp022942_Pp1s22 MDYRYPLSAFQAFAICLSSFDTKLACE
pp034734_Pp1s15 MDYRYPLSAFQAFAICLSSFDTKLACE
pp005711_Pp1s21 MDYRYPLSAFQAFAICLSSFDTKLACE
pp034759_Pp1s15 MDYRYPLSAFQAFAICLSSFDTKLACE
pp022947_Pp1s22 MDYRYPLSAFQAFAICLSSFDTKLACE
                *** **:*************:*::***


BoxShade v3.31 C (beta, 970507) Output
AT3G06380.1     - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M T F R S
pp034735_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S G S S M M P L K S
pp022942_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P L K S
pp034734_Pp1s15    M V A N G C L A V R G V R G W M L V W V I L V K R A L K R I S C G V S G S G F R V C R W G M S G R R S G S S M M P L K S
pp005711_Pp1s21    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
pp034759_Pp1s15    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P L K S
pp022947_Pp1s22    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
 
AT3G06380.1     L L - - - Q E M R - - - - - - S R - - - - - - - P H R V V H A A A S T A N S S D P F S - - - - - - - - - - - W S E L P E
pp034735_Pp1s15    L I R E F Q E M K G G R G G I S R R S F E L K F P H H - - H K G R S S G M V L D E S Q L R V E A V V K Q S C W A N M P P
pp022942_Pp1s22    L I R E F Q E M K G G I G N I S R R S F E L K F P H H - - H K G R S S G M V L D E S Q L R A E P V V E Q S C W A N M P P
pp034734_Pp1s15    L I R E F Q E M K G G R G G I S R R S F E L K F P H H - - H K G R S S G M V L D E S Q L R V E A V V K Q S C W A N M P P
pp005711_Pp1s21    - - - - - - - M K S G V G R I S R R S F E L K F P H H - - H R G R S S G M V L D E S Q L N S E P V V E Q S C W A N M P P
pp034759_Pp1s15    L I R E F Q E M K G G R G G I S R R S F E L K F P H H - - H K G R S S G M V L D E S Q L R V E A V V K Q S C W A N M P P
pp022947_Pp1s22    - - - - - - - M K G G I G N I S R R S F E L K F P H H - - H K G R S S G M V L D E S Q L R A E P V V E Q S C W A N M P P
 
AT3G06380.1     E L L R E I L I R V E T V D G G D W P S R R N V V A C A G V C R S W R I L T K E I V A V P E F S S K L T F P I S L K Q S
pp034735_Pp1s15    E L L R D V I Q R V E A S E S A - W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T F P I A L K Q P
pp022942_Pp1s22    E L L R D V I Q R V E A S E N A - W P S R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T F P I A L K Q P
pp034734_Pp1s15    E L L R D V I Q R V E A S E S A - W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T F P I A L K Q P
pp005711_Pp1s21    E L L R D V I Q R V E A S E S A - W P S R K H V V A C A A V C S S W R E V T K E L V R A P E Q S G R L T F P V A L K Q P
pp034759_Pp1s15    E L L R D V I Q R V E A S E S A - W P G R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T F P I A L K Q P
pp022947_Pp1s22    E L L R D V I Q R V E A S E N A - W P S R K H V V A C A A V C S S W R E I T K E L V R T P E Q S G R L T F P I A L K Q P
 
AT3G06380.1     G P R D S L V Q C F I K R N R N T Q S Y H L Y L G L T T S L T D N G K F L L A A S K L K R A T C T D Y I I S L R S D D I
pp034735_Pp1s15    G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S L V E N G K F L L A A R K F R R A A S T D Y I I S L N Q E D I
pp022942_Pp1s22    G P R D S T M Q C F I K R D R T T S T Y Q L F L G L P P S L V E N G K F L L A A R K C R R A T S T D Y I V S L N H E D M
pp034734_Pp1s15    G P R E S T V Q C F I K R D R T S S T Y Q L Y L G L P P S L V E N G K F L L A A R K F R R A A S T D Y I I S L N Q E D I
pp005711_Pp1s21    G P R E D T V Q C F I K R D R T T S T Y Q L F L G L P P S Q - E N G K F L L A A Q K F R R A T S T D Y I I S L N Q E D M
pp034759_Pp1s15    G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P T L V E N G K F L L A A K K F R R P T R T D Y I I S L N H D D M
pp022947_Pp1s22    G P R E N T V Q C F I K R D R T T S T Y Q L F L G L P P S L V E N G K F L L A A R K F R R A T S T D Y I I S L N Q E N M
 
AT3G06380.1     S K R S N A Y L G R M R S N F L G T K F T V F D G S Q T G A A K M Q K S R S S N F I - - - K V S P R V P Q G S Y P I A H
pp034735_Pp1s15    S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N R G A W R M G T K Q L S S R V H S G S Y N V A H
pp022942_Pp1s22    S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H S G V V A S N R G T R R L G S K Q L T S R V H C G S H N V A H
pp034734_Pp1s15    S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N R G A W R M G T K Q L S S R V H S G S Y N V A H
pp005711_Pp1s21    S R G S S T Y V G K L R S N F L G T K F T I Y D S Q P P Q N G P V L S N R S S R R L T S K Q L S Y R A H A G S F N V A H
pp034759_Pp1s15    S R G G T A Y V G K L R S N F L G T K F T I Y D S Q P S H N G V A A S N R G A W R M G T K Q L S S R V H S G S Y N V A H
pp022947_Pp1s22    S R G S N T Y V G K L R S N F L G T K F T I Y D S Q P P H S G V V A S N R G T R R M G S K Q L T S R V H C G S Y N V A H
 
AT3G06380.1     I S Y E L N V L G S R G P R R M R C I M D T I P M S I V E S R G V V A S T S - - - - - - - - - - - I S S F S S R S S P V
pp034735_Pp1s15    I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E L A A G S L E E V H V P Y S S I M S S P -
pp022942_Pp1s22    I A Y E L N V L G T R G P R R M Q C T M H S I P A S A M A S G G S A P T P T E F T S C G L E E A H V P Y S S I L L S P -
pp034734_Pp1s15    I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E L A A G S L E E V H V P Y S S I M S S P -
pp005711_Pp1s21    I A Y E L N V L G T R G P R R M Q C T L H G I P L S T M E S V G S A P S P T E V T A D S L E R A H V P H S G V M S S S -
pp034759_Pp1s15    I A Y E L N V L G T R G P R R M Q C T L H S I P A C A M E S G G S A P T P T E L A A G S L E E V H V P Y S S I M S S P -
pp022947_Pp1s22    I A Y E L N V L G T R G P R R M Q C T M H S I P A S A M A S G G S A P T P T E F T S C G L E E A H V P Y S S I L L S P -
 
AT3G06380.1     F R S H S K P L R S N S A S C S D - - S G N N L G D P P L V L S N K A P R W H E Q L R C W C L N F H G R V T V A S V K N
pp034735_Pp1s15    - R S K A A V V D S S A L E S S E F V S G L L N K E E P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N
pp022942_Pp1s22    - R S K A A V V D S S A L E S S E L V S G V L C K E E P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N
pp034734_Pp1s15    - R S K A A V V D S S A L E S S E F V S G L L N K E E P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N
pp005711_Pp1s21    - R S K A A V V D I S T L D - Y D F A S G L L A K D E P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N
pp034759_Pp1s15    - R S K A A V V D S S A L E S S E F V S G L L N K E E P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N
pp022947_Pp1s22    - R S K A A V V D S S A L E S S E L V S G V L C K E E P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V K N
 
AT3G06380.1     F Q L V A V - - - - - - - - - - - - - - - - - - - - - - - - - - - - - S D C E A G Q T S E R I I L Q F G K V G K D M F T
pp034735_Pp1s15    F Q L V A A - - - - - - T S V K A V S A A A T T - - - - - - - - - - - - - S S S S A D H D K V L L Q F G K I G K D M F T
pp022942_Pp1s22    F Q L V A A T T S S T T T S T T A G E A A A A T G G G G G A G A A T P A P T S S G S D H D K V L L Q F G K I G K D M F T
pp034734_Pp1s15    F Q L V A A - - - - - - T S V K A V S A A A T T - - - - - - - - - - - - - S S S S A D H D K V L L Q F G K I G K D M F T
pp005711_Pp1s21    F Q L V A S M E S - - - - - - - - - - - - - - - - - - - - - - - - - - L P T S S Q S D R D K V L L Q F G K I G K D I F T
pp034759_Pp1s15    F Q L V A A - - - - - - T S V K A V S A A A T T - - - - - - - - - - - - - S S S S A D H D K V L L Q F G K I G K D M F T
pp022947_Pp1s22    F Q L V A A T T S S T T T S T T A G E A A A A T G G G G G A G A A T P A P T S S G S D H D K V L L Q F G K I G K D M F T
 
AT3G06380.1     M D Y G Y P I S A F Q A F A I C L S S F E T R I A C E
pp034735_Pp1s15    M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp022942_Pp1s22    M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp034734_Pp1s15    M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp005711_Pp1s21    M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp034759_Pp1s15    M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
pp022947_Pp1s22    M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
 
0