fioreDB : Database for Flower Bio-engineering by CRES-T system
fioreDB : Database for Flower Bio-engineering by CRES-T system
Input Putative repression domain
AT3G06380.1 not found
Ortholog Putative repression domain Reverse top hit Relation Blast score ratio Type
Os029490 not found in 406aa AT2G47900.2 1st_not 0.581529581 II
Os029491 not found in 406aa AT2G47900.2 not_not 0.581529581 III
Os040209 not found in 445aa AT1G25280.1 not_not 0.516594516 III
Os029803 not found in 451aa AT1G25280.1 not_not 0.513708513 III
Os021774 not found in 445aa AT1G25280.1 not_not 0.513708513 III
Os021773 not found in 445aa AT1G25280.1 not_not 0.513708513 III
Os004869 not found in 448aa AT1G25280.1 not_not 0.494949494 III
Os019651 not found in 462aa AT1G25280.1 not_not 0.493506493 III
Os019649 not found in 462aa AT1G25280.1 not_not 0.493506493 III
Os009471 not found in 416aa AT2G18280.2 not_not 0.484848484 III
Os009468 not found in 428aa AT2G18280.2 not_not 0.484848484 III
Os003208 not found in 356aa AT1G53320.1 not_not 0.428571428 III
Os003209 not found in 356aa AT1G53320.1 not_not 0.428571428 III
Os022387 not found in 372aa AT1G53320.1 not_not 0.421356421 III
Os022386 not found in 372aa AT1G53320.1 not_not 0.421356421 III
Os022798 not found in 352aa AT1G53320.1 not_not 0.414141414 III

Get sequence file
Get alignment file
Get formatted file made by BOXSHADE
Sequence file prepared (0 sec required). Alignment has started.

CLUSTAL format alignment by MAFFT FFT-NS-2 (v7.475)


AT3G06380.1     MTFRSLLQE---M-----------------RSR---------PHRVVHA-AASTANSSDP
Os003209_Os01t0 ------------------------------MPRETPPPPPPEGGEVHEVVEGEDGQAEDQ
Os029803_Os08t0 MSFRSIVRD---VRDSFGSLSRRSF-----EVRISG-LPGLSGHHRGKS-LGSLSELRDR
Os019649_Os04t0 MSFRSIVRD---FRDSFGTLSKRSF-----EVKIS----GFSGRHRGKS-IGPSSELDDT
Os029490_Os07t0 MSFRSVIQE---VKGEIGAISRRGF-----RSR---------PGRVRRV-AAAAEEPPDE
Os022798_Os05t0 ---MAAVR----------------------EPRE----------------EAAVGEGEGE
Os009468_Os02t0 MSLKSIVRELREMRDGIGSMSRRAA-----DGRAG----GGRGGSRHSW-PVLWSEQQQP
Os040209_Os12t0 MSFRSIVRD---VRDGFGSLSRRGF-----EVRLV-------GHRRGRS-HSAVHELRDG
Os009471_Os02t0 ------------MRDGIGSMSRRAA-----DGRAG----GGRGGSRHSW-PVLWSEQQQP
Os022386_Os05t0 ---MALWRC---SSSWLSSVSRSSGGVGGGESKVSPEIAPVSGG------EGEGEEEEGE
Os019651_Os04t0 MSFRSIVRD---FRDSFGTLSKRSF-----EVKIS----GFSGRHRGKS-IGPSSELDDT
Os004869_Os01t0 MSFRSIVRD---VRDGFGSLSRRSF-----EVTLAS-LYGLTGHHKGKT-QSSLDELDDS
Os021773_Os05t0 MSFRSIVRD---VRDSFGSLSRRSF-----EVTLAG-LSGLTGHHRGKS-QSTVHELCDA
Os029491_Os07t0 MSFRSVIQE---VKGEIGAISRRGF-----RSR---------PGRVRRV-AAAAEEPPDE
Os021774_Os05t0 MSFRSIVRD---VRDSFGSLSRRSF-----EVTLAG-LSGLTGHHRGKS-QSTVHELCDA
Os003208_Os01t0 ------------------------------MPRETPPPPPPEGGEVHEVVEGEDGQAEDQ
Os022387_Os05t0 ---MALWRC---SSSWLSSVSRSSGGVGGGESKVSPEIAPVSGG------EGEGEEEEGE
                                                                       :    

AT3G06380.1     FS---------------WSELPEELLREILIRVETVDGGDWPSRRNVVACAGVCRSWRIL
Os003209_Os01t0 EE--------------RWARLLPELMSEVVRRVEASGGERWPARKDVVSCACVCRRWRDA
Os029803_Os08t0 PV---------VVDQSRWVGLPPELLRDVMKRLEEGESN-WPSRKDVVACAAVCRTWREI
Os019649_Os04t0 PV---------VAQQSKWAGLPPELLRDVMKRLEEDDSN-WPSRKDVVACASVCTTWRDM
Os029490_Os07t0 SSAAAL-----VMRESCWTQLPPELLREVLARVEESEGW-WPRRRDVVACAGVCRSWRGI
Os022798_Os05t0 EE-------------GRWGGLLPELVEEVVRRVEASGGERWPARKDLVSCACVCRRWREA
Os009468_Os02t0 PQQQQLQRQEHQQQQGRWANLPPELLLDVIQRVEASEAT-WPARRQVVACAAVCRSWREV
Os040209_Os12t0 HAAAAAA---DVVQSSCWANLPPELLRDVIERLEASEAA-WPSRKNVVACAAVCRTWRDM
Os009471_Os02t0 PQQQQLQRQEHQQQQGRWANLPPELLLDVIQRVEASEAT-WPARRQVVACAAVCRSWREV
Os022386_Os05t0 EE--------------RWSRLLPELLTEIMRRVDA-GAERWPPRRDVVACACVCRRWRDA
Os019651_Os04t0 PV---------VAQQSKWAGLPPELLRDVMKRLEEDDSN-WPSRKDVVACASVCTTWRDM
Os004869_Os01t0 PA---------IIPESRWASLPPELLREVIRRLEADEST-WPSRRNVVCFAAVCRTWREM
Os021773_Os05t0 DL---------IIQESRWASLPPELLRDVIRRLEASEST-WPSRKDVVSCAAVCKAWREM
Os029491_Os07t0 SSAAAL-----VMRESCWTQLPPELLREVLARVEESEGW-WPRRRDVVACAGVCRSWRGI
Os021774_Os05t0 DL---------IIQESRWASLPPELLRDVIRRLEASEST-WPSRKDVVSCAAVCKAWREM
Os003208_Os01t0 EE--------------RWARLLPELMSEVVRRVEASGGERWPARKDVVSCACVCRRWRDA
Os022387_Os05t0 EE--------------RWSRLLPELLTEIMRRVDA-GAERWPPRRDVVACACVCRRWRDA
                                 *  *  **: ::: *::   .  ** *:::*. * **  **  

AT3G06380.1     TKEIVAVPEFSSKLTFPISLKQSGPRDSLVQCFIKRNRNTQSYHLYLGLTTS-LTDNGKF
Os003209_Os01t0 AVAVVRPPAESGKITFPSSLKQPGPREFPMQCFIKRNKKNSTFYLYLGLTNA-TVDKGKF
Os029803_Os08t0 CKDIVQSPEICGKLTFPVSLKQPGPRDGLIQCFIKRDKSKLTYYLYLCLSPAVLSENGKF
Os019649_Os04t0 CKDIVRNPEFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKF
Os029490_Os07t0 VREIVRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKF
Os022798_Os05t0 AAAVVRPLPESGRITFPSSLKQPGPKDFPIQCFVKRNKKKSMFYLYLGLLNG-TMDKGKF
Os009468_Os02t0 TKEVVKTLEECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKL
Os040209_Os12t0 CREIVKNPEFCGKITFPVSLKQPGPRNGAIQCFIKRDKSTQTYNLYLCLSSAVLVESGKF
Os009471_Os02t0 TKEVVKTLEECGRITFPISLKQPGPREHPVQCFVRRDRATSTYLLYLGLSPSLHGENDKL
Os022386_Os05t0 AVSVVRPPLECGRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQA-LTDKGKF
Os019651_Os04t0 CKDIVRNPEFCGKLTFPVSLKQPGPRDGVIQCFIKRDKSKLTYHLYLCLSSAVLDETGKF
Os004869_Os01t0 CKETVLSPEFCGKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNVVTAEGGKF
Os021773_Os05t0 CKEIVLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKF
Os029491_Os07t0 VREIVRTPEASGNLTFPISLKQPGPRDAPMKCFIVRNRTTQTYYLYIGLTDA-LTDDGKF
Os021774_Os05t0 CKEIVLSPEFCGKLTFPLSLKQPGPRDGMIQCFIKRDKSKSTYHLYLCLSTAVLADSGKF
Os003208_Os01t0 AVAVVRPPAESGKITFPSSLKQPGPREFPMQCFIKRNKKNSTFYLYLGLTNA-TVDKGKF
Os022387_Os05t0 AVSVVRPPLECGRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQA-LTDKGKF
                    *     ...:*** *:**.**::  ::*:: *:: .  : **: *      : .*:

AT3G06380.1     LLAASKLKRATCTDYIISLRSDDISKRSNAYLGRMRSNFLGTKFTVFDGSQTGA-----A
Os003209_Os01t0 LMAARRFRRGPHTEYIVSLDADDLSQGSNAYMGKLRSDFWGTNFKIYDSKPPYDG-AKAS
Os029803_Os08t0 LLAAKRNRRATSTEYIISVDSKNISRSSNGYVGKMRSNFLGTKFVVYDTQPPYNAGSLMS
Os019649_Os04t0 LLSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCS
Os029490_Os07t0 LLAARKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPYAG-DVIS
Os022798_Os05t0 LMAARRFRRGPHTEYVISLDADDLSQGSNAYVGKLRSDFWGTNFKIYDNQPPYDD-AKTS
Os009468_Os02t0 LLAARKIRRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPN
Os040209_Os12t0 LLSAKRYSRATCTEYTIFMSADNTSRSSNMYIGKLRSNLLGTKFVIYDTQPPCNTANVSQ
Os009471_Os02t0 LLAARKIRRATRTSFVISLVSNDFSLSSSTYVGKLKPNFLGTKFTIFDSQPPCDAVVLPN
Os022386_Os05t0 LLAARRFRNGAHTEYIISYDCDDLFPGSNSYVGKLRSDFLGTKFIIYDSQPPYDG-AKPS
Os019651_Os04t0 LLSAKRSRRTTHTDYIISMDSKNISRSSSGYIGKLRSNFLGTKFIIYDTQPPYNARTLCS
Os004869_Os01t0 VLAAKRHRKTTCTEYTISMVSGNISRSSRTNIGKLRSNFLGTKFIIYDTQPPYNGAVVPH
Os021773_Os05t0 LLSAKRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPP
Os029491_Os07t0 LLAARKCRRTTCTEYLISLDMNDISKRTDSYVGKLRSNFLGTKFTIYDAHPPYAG-DVIS
Os021774_Os05t0 LLSAKRHRKTTCTEYVISMDADNISRSSSTYIGKLRSNFLGTKFIIYDTQPSYNGAVIPP
Os003208_Os01t0 LMAARRFRRGPHTEYIVSLDADDLSQGSNAYMGKLRSDFWGTNFKIYDSKPPYDG-AKAS
Os022387_Os05t0 LLAARRFRNGAHTEYIISYDCDDLFPGSNSYVGKLRSDFLGTKFIIYDSQPPYDG-AKPS
                :::* :  . . *.: :     :    :   :*:::.:: **:* ::*   .        

AT3G06380.1     KMQKSR------SSNFIKVSPRVPQGSYPIAHISYELNVLGSRGPRRMRCIMDTIPMSIV
Os003209_Os01t0 SSRSSR------RFGSRRISPQVSAGNYEVGQVSYKYNLLKSRGPRRMYCALEC------
Os029803_Os08t0 CQHGSR------RISSRRVSPKLPTGSYPIAHVKYELNVLGTRGPRRMQCTMHSIPASAV
Os019649_Os04t0 QERTSR------RFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAV
Os029490_Os07t0 KGQSAR------VIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAI
Os022798_Os05t0 STRSSQRFGSTHRFGSRRICPQISAGNFNVGQISYKYNLLKSRGPRRMFCTMEC------
Os009468_Os02t0 NRPSKR------HF--KQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCI
Os040209_Os12t0 SGKTSR------RFYSRKVSPKNPSSTYSIAQVSYELNVLGTRGPRRMNCVMHSIPASSL
Os009471_Os02t0 NRPSKR------HF--KQVSPRLPLGNYNVATVSYELTVLRNRGPRRMQCTMHSIPALCI
Os022386_Os05t0 RSQSSR------RFASKQINPNVSGGNYEVGQVSYKFNFLKSRGPRRMQCNIQC------
Os019651_Os04t0 QERTSR------RFSSRKVSPKVPTGCYPIVQVNYELNVLGTRGPRRMQCAMHSIPASAV
Os004869_Os01t0 VGRTSK------RFNSTKVSPKVPSVTYNIAQVSYELNVLGTRGPRRMRCMMHSIPASSV
Os021773_Os05t0 VGRSSR------RFNSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSV
Os029491_Os07t0 KGQSAR------VIGSNHLSPRIPAGNYPVSHISYELNVLGSRGPRRMHCAMDSIPVSAI
Os021774_Os05t0 VGRSSR------RFNSKKVSPKMPSGSYNIAQVTYELNVLGTRGPRRMHCVMHSIPASSV
Os003208_Os01t0 SSRSSR------RFGSRRISPQVSAGNYEVGQVSYKYNLLKSRGPRRMYCALEC------
Os022387_Os05t0 RSQSSR------RFASKQINPNVSGGNYEVGQVSYKFNFLKSRGPRRMQCNIQC------
                     :           :: *. .   : :  :.*: ..* .****** * :.       

AT3G06380.1     ESRGVVAST--SISSFSSRSS------PVFRS-----------HSKPL------RSNSAS
Os003209_Os01t0 ---------------------------PSTQE----T------WENCL------KTKFRK
Os029803_Os08t0 DPEGVVPGQPEQLLPGPFEESFRSTNTS-SRF---------SFMDRSL------DFSSSR
Os019649_Os04t0 EPGGIVPGQPKELLPRLFEESFRSMATSFSKY---------SITDHST------DFSSSR
Os029490_Os07t0 EQGGTAPTQ--TEFPLSYHESFTSI--PFFK-------------SKSV------RANNST
Os022798_Os05t0 ---------------------------PSTQE----T------WENSL------KTKSLR
Os009468_Os02t0 QEGGKAPTP--TGIIHSLDEQVPAL--STSKG-----------KEPAI------EFSSTS
Os040209_Os12t0 EAGGTVPCQPDSVLARSLDESFGSI--SFSKS---------SIMDRSI------RFSSSR
Os009471_Os02t0 QEGGKAPTP--TGIIHSLDEQVPAL--STSKG-----------KEPAI------EFSSTS
Os022386_Os05t0 ---------------------------PVGQS----T------ASDPL------K-KLIS
Os019651_Os04t0 EPGGIVPGQPKELLPRLFEESFRSMATSFSKY---------SITDHST------DFSSSR
Os004869_Os01t0 EPGGIVPGQPEQIVPRALEDSFRST-TSFSQSFRSTTSFSKSIMDPSM------DFSSAR
Os021773_Os05t0 EPGGIVPGQPEQIVPRAFEESFRST-TSFSKS---------SIMDRSMDFSSSRDFSSAR
Os029491_Os07t0 EQGGTAPTQ--TEFPLSYHESFTSI--PFFK-------------SKSV------RANNST
Os021774_Os05t0 EPGGIVPGQPEQIVPRAFEESFRST-TSFSKS---------SIMDRSMDFSSSRDFSSAR
Os003208_Os01t0 ---------------------------PSTQE----T------WENCL------KTKFRK
Os022387_Os05t0 ---------------------------PVGQS----T------ASDPL------K-KLIS
                                           .  :             .           .   

AT3G06380.1     CS-DSG-----------NNLGDP------PLVLSNKAPRWHEQLRCWCLNFHGRVTVASV
Os003209_Os01t0 PT-----G---------------------NTVLRNKAPRWHEHLQCWCLNFHGRVTVASV
Os029803_Os08t0 FS-EIS-GSANQ-----QGEDDIPEAKERPLVLRNKVPRWHEQLQCWCLNFRGRVTVASV
Os019649_Os04t0 FS-EFG-GGALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASV
Os029490_Os07t0 AS-LLT-----------QN--GS------KLVLKNKSPRWHEHLQCWCLNFHGRVTVASV
Os022798_Os05t0 CT-----G---------------------TTVLRNKAPRWHEHLQCWCLNFHGRVTVASV
Os009468_Os02t0 LSADLS-GPVC--------------TNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASV
Os040209_Os12t0 YS-DISVGGPMVGG---QALGDSDESKERPLILRNKAPRWHEQLQCWCLNFKGRVTVASV
Os009471_Os02t0 LSADLS-GPVC--------------TNEVPLVLKNKAPRWHEQLQCWCLNFRGRVTVASV
Os022386_Os05t0 TS-----S---------------------PLALRNKAPRWHEHLQCWCLNFHGRVTVASV
Os019651_Os04t0 FS-EFG-GGALQGQEQEQDGDDV--NKERPLVLRNKAPRWHEQLQCWCLNFRGRVTVASV
Os004869_Os01t0 FS-DIS-GSI-------MGGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIASV
Os021773_Os05t0 FS-DIA-GGT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASV
Os029491_Os07t0 AS-LLT-----------QN--GS------KLVLKNKSPRWHEHLQCWCLNFHGRVTVASV
Os021774_Os05t0 FS-DIA-GGT-------INGDEEGQNKERPLVLRNKAPRWHEQLQCWCLNFRGRVTIASV
Os003208_Os01t0 PT-----G---------------------NTVLRNKAPRWHEHLQCWCLNFHGRVTVASV
Os022387_Os05t0 TS-----S---------------------PLALRNKAPRWHEHLQCWCLNFHGRVTVASV
                 :                              * ** *****:*:******:****:***

AT3G06380.1     KNFQLVAVS----------DCE--------------------AGQTSERIILQFGKVGKD
Os003209_Os01t0 KNFQLVAAAD---------PNDP------------------ASSKDEETVLLQFGKVDDN
Os029803_Os08t0 KNFQLIAAA----------SSESSQLEQQQQQQQQNHASSSSSASDHGKVILQFGKVGKD
Os019649_Os04t0 KNFQLIAAAPQPSSGAASEPSQAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAKD
Os029490_Os07t0 KNFQLVASD----------ESNP-------------------TNQEHDDVILQFGKVGKD
Os022798_Os05t0 KNFQLVATAD---------PSHP------------------DSVGDEETVILQFGKVDSN
Os009468_Os02t0 KNFQLVASV-DPSLGIPA--------------------------AEQEKVILQFGKIGKD
Os040209_Os12t0 KNFQLVAAT-QPAAGAPT-PSQPAPPPP----------------PDHDKVILQFGKVAKD
Os009471_Os02t0 KNFQLVASV-DPSLGIPA--------------------------AEQEKVILQFGKIGKD
Os022386_Os05t0 KNFQLVAPAG---------TSDP------------------WGIADEETVILQFGKIEDD
Os019651_Os04t0 KNFQLIAAAPQPSSGAASEPSQAGQAAQQQTQPSQPSSSSSSSSSNHDTVILQFGKVAKD
Os004869_Os01t0 KNFQLVAAPSPPPAGAPT-PSQPGPADP-------------------EKVILQFGKVARD
Os021773_Os05t0 KNFQLIAAPAQPPAGAPT-PSQPAPPEQ-------------------DKIILQFGKVAKD
Os029491_Os07t0 KNFQLVASD----------ESNP-------------------TNQEHDDVILQFGKVGKD
Os021774_Os05t0 KNFQLIAAPAQPPAGAPT-PSQPAPPEQ-------------------DKIILQFGKVAKD
Os003208_Os01t0 KNFQLVAAAD---------PNDP------------------ASSKDEETVLLQFGKVDDN
Os022387_Os05t0 KNFQLVAPAG---------TSDP------------------WGIADEETVILQFGKIEDD
                *****:*                                          ::*****:  :

AT3G06380.1     MFTMDYGYPISAFQAFAICLSSFETRIACE
Os003209_Os01t0 IFTMDYRQPLSAFQAFAISLSSFGTKLACE
Os029803_Os08t0 MFTMDYRYPLSAFQAFAICLTSFDTKLACE
Os019649_Os04t0 MFTMDYRYPLSAFQAFAICLTSFDTKLACE
Os029490_Os07t0 MFTMDYRYPISAFQAFAICLSSFDTKIACE
Os022798_Os05t0 IFTMDYRQPLSAFQAFAICLSSFGTKLACE
Os009468_Os02t0 IFTMDYRYPLSAFQAFAICLTSFDTKPACE
Os040209_Os12t0 MFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os009471_Os02t0 IFTMDYRYPLSAFQAFAICLTSFDTKPACE
Os022386_Os05t0 AFTMDYRQPLSAFQAFAICLTSFGTKLACE
Os019651_Os04t0 MFTMDYRYPLSAFQAFAICLTSFDTKLACE
Os004869_Os01t0 MFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os021773_Os05t0 MFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os029491_Os07t0 MFTMDYRYPISAFQAFAICLSSFDTKIACE
Os021774_Os05t0 MFTMDYRYPLSAFQAFAICLSSFDTKLACE
Os003208_Os01t0 IFTMDYRQPLSAFQAFAISLSSFGTKLACE
Os022387_Os05t0 AFTMDYRQPLSAFQAFAICLTSFGTKLACE
                 *****  *:********.*:** *: ***


BoxShade v3.31 C (beta, 970507) Output
AT3G06380.1     M T F R S L L Q E - - - M - - - - - - - - - - - - - - - - - R S R - - - - - - - - - P H R V V H A - A A S T A N S S D P
Os003209_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P R E T P P P P P P E G G E V H E V V E G E D G Q A E D Q
Os029803_Os08t0    M S F R S I V R D - - - V R D S F G S L S R R S F - - - - - E V R I S G - L P G L S G H H R G K S - L G S L S E L R D R
Os019649_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F - - - - - E V K I S - - - - G F S G R H R G K S - I G P S S E L D D T
Os029490_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F - - - - - R S R - - - - - - - - - P G R V R R V - A A A A E E P P D E
Os022798_Os05t0    - - - M A A V R - - - - - - - - - - - - - - - - - - - - - - E P R E - - - - - - - - - - - - - - - - E A A V G E G E G E
Os009468_Os02t0    M S L K S I V R E L R E M R D G I G S M S R R A A - - - - - D G R A G - - - - G G R G G S R H S W - P V L W S E Q Q Q P
Os040209_Os12t0    M S F R S I V R D - - - V R D G F G S L S R R G F - - - - - E V R L V - - - - - - - G H R R G R S - H S A V H E L R D G
Os009471_Os02t0    - - - - - - - - - - - - M R D G I G S M S R R A A - - - - - D G R A G - - - - G G R G G S R H S W - P V L W S E Q Q Q P
Os022386_Os05t0    - - - M A L W R C - - - S S S W L S S V S R S S G G V G G G E S K V S P E I A P V S G G - - - - - - E G E G E E E E G E
Os019651_Os04t0    M S F R S I V R D - - - F R D S F G T L S K R S F - - - - - E V K I S - - - - G F S G R H R G K S - I G P S S E L D D T
Os004869_Os01t0    M S F R S I V R D - - - V R D G F G S L S R R S F - - - - - E V T L A S - L Y G L T G H H K G K T - Q S S L D E L D D S
Os021773_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F - - - - - E V T L A G - L S G L T G H H R G K S - Q S T V H E L C D A
Os029491_Os07t0    M S F R S V I Q E - - - V K G E I G A I S R R G F - - - - - R S R - - - - - - - - - P G R V R R V - A A A A E E P P D E
Os021774_Os05t0    M S F R S I V R D - - - V R D S F G S L S R R S F - - - - - E V T L A G - L S G L T G H H R G K S - Q S T V H E L C D A
Os003208_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M P R E T P P P P P P E G G E V H E V V E G E D G Q A E D Q
Os022387_Os05t0    - - - M A L W R C - - - S S S W L S S V S R S S G G V G G G E S K V S P E I A P V S G G - - - - - - E G E G E E E E G E
 
AT3G06380.1     F S - - - - - - - - - - - - - - - W S E L P E E L L R E I L I R V E T V D G G D W P S R R N V V A C A G V C R S W R I L
Os003209_Os01t0    E E - - - - - - - - - - - - - - R W A R L L P E L M S E V V R R V E A S G G E R W P A R K D V V S C A C V C R R W R D A
Os029803_Os08t0    P V - - - - - - - - - V V D Q S R W V G L P P E L L R D V M K R L E E G E S N - W P S R K D V V A C A A V C R T W R E I
Os019649_Os04t0    P V - - - - - - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N - W P S R K D V V A C A S V C T T W R D M
Os029490_Os07t0    S S A A A L - - - - - V M R E S C W T Q L P P E L L R E V L A R V E E S E G W - W P R R R D V V A C A G V C R S W R G I
Os022798_Os05t0    E E - - - - - - - - - - - - - G R W G G L L P E L V E E V V R R V E A S G G E R W P A R K D L V S C A C V C R R W R E A
Os009468_Os02t0    P Q Q Q Q L Q R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T - W P A R R Q V V A C A A V C R S W R E V
Os040209_Os12t0    H A A A A A A - - - D V V Q S S C W A N L P P E L L R D V I E R L E A S E A A - W P S R K N V V A C A A V C R T W R D M
Os009471_Os02t0    P Q Q Q Q L Q R Q E H Q Q Q Q G R W A N L P P E L L L D V I Q R V E A S E A T - W P A R R Q V V A C A A V C R S W R E V
Os022386_Os05t0    E E - - - - - - - - - - - - - - R W S R L L P E L L T E I M R R V D A - G A E R W P P R R D V V A C A C V C R R W R D A
Os019651_Os04t0    P V - - - - - - - - - V A Q Q S K W A G L P P E L L R D V M K R L E E D D S N - W P S R K D V V A C A S V C T T W R D M
Os004869_Os01t0    P A - - - - - - - - - I I P E S R W A S L P P E L L R E V I R R L E A D E S T - W P S R R N V V C F A A V C R T W R E M
Os021773_Os05t0    D L - - - - - - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T - W P S R K D V V S C A A V C K A W R E M
Os029491_Os07t0    S S A A A L - - - - - V M R E S C W T Q L P P E L L R E V L A R V E E S E G W - W P R R R D V V A C A G V C R S W R G I
Os021774_Os05t0    D L - - - - - - - - - I I Q E S R W A S L P P E L L R D V I R R L E A S E S T - W P S R K D V V S C A A V C K A W R E M
Os003208_Os01t0    E E - - - - - - - - - - - - - - R W A R L L P E L M S E V V R R V E A S G G E R W P A R K D V V S C A C V C R R W R D A
Os022387_Os05t0    E E - - - - - - - - - - - - - - R W S R L L P E L L T E I M R R V D A - G A E R W P P R R D V V A C A C V C R R W R D A
 
AT3G06380.1     T K E I V A V P E F S S K L T F P I S L K Q S G P R D S L V Q C F I K R N R N T Q S Y H L Y L G L T T S - L T D N G K F
Os003209_Os01t0    A V A V V R P P A E S G K I T F P S S L K Q P G P R E F P M Q C F I K R N K K N S T F Y L Y L G L T N A - T V D K G K F
Os029803_Os08t0    C K D I V Q S P E I C G K L T F P V S L K Q P G P R D G L I Q C F I K R D K S K L T Y Y L Y L C L S P A V L S E N G K F
Os019649_Os04t0    C K D I V R N P E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F
Os029490_Os07t0    V R E I V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F
Os022798_Os05t0    A A A V V R P L P E S G R I T F P S S L K Q P G P K D F P I Q C F V K R N K K K S M F Y L Y L G L L N G - T M D K G K F
Os009468_Os02t0    T K E V V K T L E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L
Os040209_Os12t0    C R E I V K N P E F C G K I T F P V S L K Q P G P R N G A I Q C F I K R D K S T Q T Y N L Y L C L S S A V L V E S G K F
Os009471_Os02t0    T K E V V K T L E E C G R I T F P I S L K Q P G P R E H P V Q C F V R R D R A T S T Y L L Y L G L S P S L H G E N D K L
Os022386_Os05t0    A V S V V R P P L E C G R I T F P S S L K Q P G P R D A P M H C F I R R N K K N S T F Y L Y L S L T Q A - L T D K G K F
Os019651_Os04t0    C K D I V R N P E F C G K L T F P V S L K Q P G P R D G V I Q C F I K R D K S K L T Y H L Y L C L S S A V L D E T G K F
Os004869_Os01t0    C K E T V L S P E F C G K L T F P V S I K Q P G P R D G M I Q C Y I K R N R S K S T Y H L Y L C L S N V V T A E G G K F
Os021773_Os05t0    C K E I V L S P E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F
Os029491_Os07t0    V R E I V R T P E A S G N L T F P I S L K Q P G P R D A P M K C F I V R N R T T Q T Y Y L Y I G L T D A - L T D D G K F
Os021774_Os05t0    C K E I V L S P E F C G K L T F P L S L K Q P G P R D G M I Q C F I K R D K S K S T Y H L Y L C L S T A V L A D S G K F
Os003208_Os01t0    A V A V V R P P A E S G K I T F P S S L K Q P G P R E F P M Q C F I K R N K K N S T F Y L Y L G L T N A - T V D K G K F
Os022387_Os05t0    A V S V V R P P L E C G R I T F P S S L K Q P G P R D A P M H C F I R R N K K N S T F Y L Y L S L T Q A - L T D K G K F
 
AT3G06380.1     L L A A S K L K R A T C T D Y I I S L R S D D I S K R S N A Y L G R M R S N F L G T K F T V F D G S Q T G A - - - - - A
Os003209_Os01t0    L M A A R R F R R G P H T E Y I V S L D A D D L S Q G S N A Y M G K L R S D F W G T N F K I Y D S K P P Y D G - A K A S
Os029803_Os08t0    L L A A K R N R R A T S T E Y I I S V D S K N I S R S S N G Y V G K M R S N F L G T K F V V Y D T Q P P Y N A G S L M S
Os019649_Os04t0    L L S A K R S R R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S
Os029490_Os07t0    L L A A R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y A G - D V I S
Os022798_Os05t0    L M A A R R F R R G P H T E Y V I S L D A D D L S Q G S N A Y V G K L R S D F W G T N F K I Y D N Q P P Y D D - A K T S
Os009468_Os02t0    L L A A R K I R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N
Os040209_Os12t0    L L S A K R Y S R A T C T E Y T I F M S A D N T S R S S N M Y I G K L R S N L L G T K F V I Y D T Q P P C N T A N V S Q
Os009471_Os02t0    L L A A R K I R R A T R T S F V I S L V S N D F S L S S S T Y V G K L K P N F L G T K F T I F D S Q P P C D A V V L P N
Os022386_Os05t0    L L A A R R F R N G A H T E Y I I S Y D C D D L F P G S N S Y V G K L R S D F L G T K F I I Y D S Q P P Y D G - A K P S
Os019651_Os04t0    L L S A K R S R R T T H T D Y I I S M D S K N I S R S S S G Y I G K L R S N F L G T K F I I Y D T Q P P Y N A R T L C S
Os004869_Os01t0    V L A A K R H R K T T C T E Y T I S M V S G N I S R S S R T N I G K L R S N F L G T K F I I Y D T Q P P Y N G A V V P H
Os021773_Os05t0    L L S A K R H R K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P
Os029491_Os07t0    L L A A R K C R R T T C T E Y L I S L D M N D I S K R T D S Y V G K L R S N F L G T K F T I Y D A H P P Y A G - D V I S
Os021774_Os05t0    L L S A K R H R K T T C T E Y V I S M D A D N I S R S S S T Y I G K L R S N F L G T K F I I Y D T Q P S Y N G A V I P P
Os003208_Os01t0    L M A A R R F R R G P H T E Y I V S L D A D D L S Q G S N A Y M G K L R S D F W G T N F K I Y D S K P P Y D G - A K A S
Os022387_Os05t0    L L A A R R F R N G A H T E Y I I S Y D C D D L F P G S N S Y V G K L R S D F L G T K F I I Y D S Q P P Y D G - A K P S
 
AT3G06380.1     K M Q K S R - - - - - - S S N F I K V S P R V P Q G S Y P I A H I S Y E L N V L G S R G P R R M R C I M D T I P M S I V
Os003209_Os01t0    S S R S S R - - - - - - R F G S R R I S P Q V S A G N Y E V G Q V S Y K Y N L L K S R G P R R M Y C A L E C - - - - - -
Os029803_Os08t0    C Q H G S R - - - - - - R I S S R R V S P K L P T G S Y P I A H V K Y E L N V L G T R G P R R M Q C T M H S I P A S A V
Os019649_Os04t0    Q E R T S R - - - - - - R F S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V
Os029490_Os07t0    K G Q S A R - - - - - - V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I
Os022798_Os05t0    S T R S S Q R F G S T H R F G S R R I C P Q I S A G N F N V G Q I S Y K Y N L L K S R G P R R M F C T M E C - - - - - -
Os009468_Os02t0    N R P S K R - - - - - - H F - - K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I
Os040209_Os12t0    S G K T S R - - - - - - R F Y S R K V S P K N P S S T Y S I A Q V S Y E L N V L G T R G P R R M N C V M H S I P A S S L
Os009471_Os02t0    N R P S K R - - - - - - H F - - K Q V S P R L P L G N Y N V A T V S Y E L T V L R N R G P R R M Q C T M H S I P A L C I
Os022386_Os05t0    R S Q S S R - - - - - - R F A S K Q I N P N V S G G N Y E V G Q V S Y K F N F L K S R G P R R M Q C N I Q C - - - - - -
Os019651_Os04t0    Q E R T S R - - - - - - R F S S R K V S P K V P T G C Y P I V Q V N Y E L N V L G T R G P R R M Q C A M H S I P A S A V
Os004869_Os01t0    V G R T S K - - - - - - R F N S T K V S P K V P S V T Y N I A Q V S Y E L N V L G T R G P R R M R C M M H S I P A S S V
Os021773_Os05t0    V G R S S R - - - - - - R F N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V
Os029491_Os07t0    K G Q S A R - - - - - - V I G S N H L S P R I P A G N Y P V S H I S Y E L N V L G S R G P R R M H C A M D S I P V S A I
Os021774_Os05t0    V G R S S R - - - - - - R F N S K K V S P K M P S G S Y N I A Q V T Y E L N V L G T R G P R R M H C V M H S I P A S S V
Os003208_Os01t0    S S R S S R - - - - - - R F G S R R I S P Q V S A G N Y E V G Q V S Y K Y N L L K S R G P R R M Y C A L E C - - - - - -
Os022387_Os05t0    R S Q S S R - - - - - - R F A S K Q I N P N V S G G N Y E V G Q V S Y K F N F L K S R G P R R M Q C N I Q C - - - - - -
 
AT3G06380.1     E S R G V V A S T - - S I S S F S S R S S - - - - - - P V F R S - - - - - - - - - - - H S K P L - - - - - - R S N S A S
Os003209_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - P S T Q E - - - - T - - - - - - W E N C L - - - - - - K T K F R K
Os029803_Os08t0    D P E G V V P G Q P E Q L L P G P F E E S F R S T N T S - S R F - - - - - - - - - S F M D R S L - - - - - - D F S S S R
Os019649_Os04t0    E P G G I V P G Q P K E L L P R L F E E S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S R
Os029490_Os07t0    E Q G G T A P T Q - - T E F P L S Y H E S F T S I - - P F F K - - - - - - - - - - - - - S K S V - - - - - - R A N N S T
Os022798_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - P S T Q E - - - - T - - - - - - W E N S L - - - - - - K T K S L R
Os009468_Os02t0    Q E G G K A P T P - - T G I I H S L D E Q V P A L - - S T S K G - - - - - - - - - - - K E P A I - - - - - - E F S S T S
Os040209_Os12t0    E A G G T V P C Q P D S V L A R S L D E S F G S I - - S F S K S - - - - - - - - - S I M D R S I - - - - - - R F S S S R
Os009471_Os02t0    Q E G G K A P T P - - T G I I H S L D E Q V P A L - - S T S K G - - - - - - - - - - - K E P A I - - - - - - E F S S T S
Os022386_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - P V G Q S - - - - T - - - - - - A S D P L - - - - - - K - K L I S
Os019651_Os04t0    E P G G I V P G Q P K E L L P R L F E E S F R S M A T S F S K Y - - - - - - - - - S I T D H S T - - - - - - D F S S S R
Os004869_Os01t0    E P G G I V P G Q P E Q I V P R A L E D S F R S T - T S F S Q S F R S T T S F S K S I M D P S M - - - - - - D F S S A R
Os021773_Os05t0    E P G G I V P G Q P E Q I V P R A F E E S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A R
Os029491_Os07t0    E Q G G T A P T Q - - T E F P L S Y H E S F T S I - - P F F K - - - - - - - - - - - - - S K S V - - - - - - R A N N S T
Os021774_Os05t0    E P G G I V P G Q P E Q I V P R A F E E S F R S T - T S F S K S - - - - - - - - - S I M D R S M D F S S S R D F S S A R
Os003208_Os01t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - P S T Q E - - - - T - - - - - - W E N C L - - - - - - K T K F R K
Os022387_Os05t0    - - - - - - - - - - - - - - - - - - - - - - - - - - - P V G Q S - - - - T - - - - - - A S D P L - - - - - - K - K L I S
 
AT3G06380.1     C S - D S G - - - - - - - - - - - N N L G D P - - - - - - P L V L S N K A P R W H E Q L R C W C L N F H G R V T V A S V
Os003209_Os01t0    P T - - - - - G - - - - - - - - - - - - - - - - - - - - - N T V L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
Os029803_Os08t0    F S - E I S - G S A N Q - - - - - Q G E D D I P E A K E R P L V L R N K V P R W H E Q L Q C W C L N F R G R V T V A S V
Os019649_Os04t0    F S - E F G - G G A L Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os029490_Os07t0    A S - L L T - - - - - - - - - - - Q N - - G S - - - - - - K L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V
Os022798_Os05t0    C T - - - - - G - - - - - - - - - - - - - - - - - - - - - T T V L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
Os009468_Os02t0    L S A D L S - G P V C - - - - - - - - - - - - - - T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os040209_Os12t0    Y S - D I S V G G P M V G G - - - Q A L G D S D E S K E R P L I L R N K A P R W H E Q L Q C W C L N F K G R V T V A S V
Os009471_Os02t0    L S A D L S - G P V C - - - - - - - - - - - - - - T N E V P L V L K N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os022386_Os05t0    T S - - - - - S - - - - - - - - - - - - - - - - - - - - - P L A L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
Os019651_Os04t0    F S - E F G - G G A L Q G Q E Q E Q D G D D V - - N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T V A S V
Os004869_Os01t0    F S - D I S - G S I - - - - - - - M G G D D N G E I K E R P L V L R N K P P R W H E Q L Q C W C L N F R G R V T I A S V
Os021773_Os05t0    F S - D I A - G G T - - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V
Os029491_Os07t0    A S - L L T - - - - - - - - - - - Q N - - G S - - - - - - K L V L K N K S P R W H E H L Q C W C L N F H G R V T V A S V
Os021774_Os05t0    F S - D I A - G G T - - - - - - - I N G D E E G Q N K E R P L V L R N K A P R W H E Q L Q C W C L N F R G R V T I A S V
Os003208_Os01t0    P T - - - - - G - - - - - - - - - - - - - - - - - - - - - N T V L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
Os022387_Os05t0    T S - - - - - S - - - - - - - - - - - - - - - - - - - - - P L A L R N K A P R W H E H L Q C W C L N F H G R V T V A S V
 
AT3G06380.1     K N F Q L V A V S - - - - - - - - - - D C E - - - - - - - - - - - - - - - - - - - - A G Q T S E R I I L Q F G K V G K D
Os003209_Os01t0    K N F Q L V A A A D - - - - - - - - - P N D P - - - - - - - - - - - - - - - - - - A S S K D E E T V L L Q F G K V D D N
Os029803_Os08t0    K N F Q L I A A A - - - - - - - - - - S S E S S Q L E Q Q Q Q Q Q Q Q N H A S S S S S A S D H G K V I L Q F G K V G K D
Os019649_Os04t0    K N F Q L I A A A P Q P S S G A A S E P S Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F G K V A K D
Os029490_Os07t0    K N F Q L V A S D - - - - - - - - - - E S N P - - - - - - - - - - - - - - - - - - - T N Q E H D D V I L Q F G K V G K D
Os022798_Os05t0    K N F Q L V A T A D - - - - - - - - - P S H P - - - - - - - - - - - - - - - - - - D S V G D E E T V I L Q F G K V D S N
Os009468_Os02t0    K N F Q L V A S V - D P S L G I P A - - - - - - - - - - - - - - - - - - - - - - - - - - A E Q E K V I L Q F G K I G K D
Os040209_Os12t0    K N F Q L V A A T - Q P A A G A P T - P S Q P A P P P P - - - - - - - - - - - - - - - - P D H D K V I L Q F G K V A K D
Os009471_Os02t0    K N F Q L V A S V - D P S L G I P A - - - - - - - - - - - - - - - - - - - - - - - - - - A E Q E K V I L Q F G K I G K D
Os022386_Os05t0    K N F Q L V A P A G - - - - - - - - - T S D P - - - - - - - - - - - - - - - - - - W G I A D E E T V I L Q F G K I E D D
Os019651_Os04t0    K N F Q L I A A A P Q P S S G A A S E P S Q A G Q A A Q Q Q T Q P S Q P S S S S S S S S S N H D T V I L Q F G K V A K D
Os004869_Os01t0    K N F Q L V A A P S P P P A G A P T - P S Q P G P A D P - - - - - - - - - - - - - - - - - - - E K V I L Q F G K V A R D
Os021773_Os05t0    K N F Q L I A A P A Q P P A G A P T - P S Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F G K V A K D
Os029491_Os07t0    K N F Q L V A S D - - - - - - - - - - E S N P - - - - - - - - - - - - - - - - - - - T N Q E H D D V I L Q F G K V G K D
Os021774_Os05t0    K N F Q L I A A P A Q P P A G A P T - P S Q P A P P E Q - - - - - - - - - - - - - - - - - - - D K I I L Q F G K V A K D
Os003208_Os01t0    K N F Q L V A A A D - - - - - - - - - P N D P - - - - - - - - - - - - - - - - - - A S S K D E E T V L L Q F G K V D D N
Os022387_Os05t0    K N F Q L V A P A G - - - - - - - - - T S D P - - - - - - - - - - - - - - - - - - W G I A D E E T V I L Q F G K I E D D
 
AT3G06380.1     M F T M D Y G Y P I S A F Q A F A I C L S S F E T R I A C E
Os003209_Os01t0    I F T M D Y R Q P L S A F Q A F A I S L S S F G T K L A C E
Os029803_Os08t0    M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os019649_Os04t0    M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os029490_Os07t0    M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
Os022798_Os05t0    I F T M D Y R Q P L S A F Q A F A I C L S S F G T K L A C E
Os009468_Os02t0    I F T M D Y R Y P L S A F Q A F A I C L T S F D T K P A C E
Os040209_Os12t0    M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os009471_Os02t0    I F T M D Y R Y P L S A F Q A F A I C L T S F D T K P A C E
Os022386_Os05t0    A F T M D Y R Q P L S A F Q A F A I C L T S F G T K L A C E
Os019651_Os04t0    M F T M D Y R Y P L S A F Q A F A I C L T S F D T K L A C E
Os004869_Os01t0    M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os021773_Os05t0    M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os029491_Os07t0    M F T M D Y R Y P I S A F Q A F A I C L S S F D T K I A C E
Os021774_Os05t0    M F T M D Y R Y P L S A F Q A F A I C L S S F D T K L A C E
Os003208_Os01t0    I F T M D Y R Q P L S A F Q A F A I S L S S F G T K L A C E
Os022387_Os05t0    A F T M D Y R Q P L S A F Q A F A I C L T S F G T K L A C E
 
0